DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SFN and 14-3-3zeta

DIOPT Version :9

Sequence 1:NP_006133.1 Gene:SFN / 2810 HGNCID:10773 Length:248 Species:Homo sapiens
Sequence 2:NP_001014515.1 Gene:14-3-3zeta / 36059 FlyBaseID:FBgn0004907 Length:248 Species:Drosophila melanogaster


Alignment Length:245 Identity:162/245 - (66%)
Similarity:198/245 - (80%) Gaps:4/245 - (1%)


- Green bases have known domain annotations that are detailed below.


Human     1 MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSI 65
            :::..|:||||||||:|||:|||..||...|.|.|||.|||||||||||||||.:|::|||:|||
  Fly     4 VDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSI 68

Human    66 EQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRY 130
            |||:  |.|..|....|||||:||.||:.:|..||||||.:||.:|.:.||:|||||||||||||
  Fly    69 EQKT--EASARKQQLAREYRERVEKELREICYEVLGLLDKYLIPKASNPESKVFYLKMKGDYYRY 131

Human   131 LAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAK 195
            ||||||||.:..::|.:::|||:|.||||.:|.||:|||||||||||||:|||.|||::|..|||
  Fly   132 LAEVATGDARNTVVDDSQTAYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAK 196

Human   196 TTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQE 245
            ..||:|:|:|.||:||||||||||||||||||||||:|..|:|.  .|||
  Fly   197 QAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEA--EPQE 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SFNNP_006133.1 14-3-3_sigma 1..242 CDD:206756 159/240 (66%)
14-3-3zetaNP_001014515.1 14-3-3 5..234 CDD:413191 156/230 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159673
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5040
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53683
OrthoDB 1 1.010 - - D1176818at2759
OrthoFinder 1 1.000 - - FOG0000128
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18860
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.