DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atp5o and ATPsynO

DIOPT Version :9

Sequence 1:NP_613063.1 Gene:Atp5o / 28080 MGIID:106341 Length:213 Species:Mus musculus
Sequence 2:NP_524358.2 Gene:ATPsynO / 41845 FlyBaseID:FBgn0016691 Length:209 Species:Drosophila melanogaster


Alignment Length:196 Identity:94/196 - (47%)
Similarity:132/196 - (67%) Gaps:7/196 - (3%)


- Green bases have known domain annotations that are detailed below.


Mouse     9 LSRQVRSFSTSVVRPFAKLVRPPVQVYGIEGRYATALYSAASKEKKLDQVEKELLRVGQLLK-DP 72
            |||.:.|.:....      |:|||||:|:||||||||||||||..:||||||:|..:...:: |.
  Fly    10 LSRTLSSAAAQAT------VKPPVQVFGLEGRYATALYSAASKLSQLDQVEKDLTALQATIRSDK 68

Mouse    73 KVSLAVLNPYIKRTVKVKSLNDITKREKFSPLTANLMNLLAENGRLGNTQGIISAFSTIMSVHRG 137
            |:...|.:|.|.:.|...:|.:.:::.:|:|.|.||:.|||:||||.....:|:|:.|||:.|||
  Fly    69 KLREYVTSPIINKKVMATALKEASEKLRFAPATVNLLGLLADNGRLKKLDTVINAYKTIMAAHRG 133

Mouse   138 EVPCTVTTASPLDDAVLSELKTVLKSFLSPNQILKLEIKTDPSIMGGMIVRIGEKYVDMSAKSKI 202
            ||.|.|.||.|||.:...:|:..|||||..|:.||:..:.||||:||:||.||:||||||..:|:
  Fly   134 EVVCEVVTAKPLDASQSKQLEGALKSFLKGNESLKITSRVDPSIIGGLIVSIGDKYVDMSIATKV 198

Mouse   203 Q 203
            :
  Fly   199 K 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atp5oNP_613063.1 OSCP 37..209 CDD:306679 83/168 (49%)
ATPsynONP_524358.2 OSCP 32..199 CDD:278635 83/166 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850711
Domainoid 1 1.000 160 1.000 Domainoid score I4055
eggNOG 1 0.900 - - E1_COG0712
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1283
Inparanoid 1 1.050 177 1.000 Inparanoid score I4030
Isobase 1 0.950 - 0 Normalized mean entropy S1100
OMA 1 1.010 - - QHG57719
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004090
OrthoInspector 1 1.000 - - oto92530
orthoMCL 1 0.900 - - OOG6_101031
Panther 1 1.100 - - LDO PTHR11910
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R121
SonicParanoid 1 1.000 - - X3931
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1716.740

Return to query results.
Submit another query.