Sequence 1: | NP_957001.1 | Gene: | rdh8a / 280648 | ZFINID: | ZDB-GENE-021115-3 | Length: | 318 | Species: | Danio rerio |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_608616.2 | Gene: | CG31937 / 326177 | FlyBaseID: | FBgn0031360 | Length: | 321 | Species: | Drosophila melanogaster |
Alignment Length: | 204 | Identity: | 61/204 - (29%) |
---|---|---|---|
Similarity: | 109/204 - (53%) | Gaps: | 15/204 - (7%) |
- Green bases have known domain annotations that are detailed below.
Zfish 1 MASGGGQKVVLITGCSSGIGLRIAVLLARDEQKRYHVIATMRDLKKKDRLVE-----AAGEVYGQ 60
Zfish 61 TLTLLPLDICSDESVRQCVNSVKD--RHIDVLINNAGVGLLGPVESISMDEMKRVFETNFFGTVR 123
Zfish 124 MIKEVMPDMKKRQA--GHIIIMSSVMGLQGVVFNDVYTASKFAIEGFCESMAVQLLKFNVKLSLI 186
Zfish 187 EPGPVHTEF 195 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rdh8a | NP_957001.1 | type1_17beta-HSD-like_SDR_c | 8..265 | CDD:187666 | 58/197 (29%) |
adh_short | 8..207 | CDD:278532 | 58/197 (29%) | ||
CG31937 | NP_608616.2 | NADB_Rossmann | 44..293 | CDD:304358 | 60/201 (30%) |
adh_short | 47..245 | CDD:278532 | 59/198 (30%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1205 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |