DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ing4 and MESR4

DIOPT Version :9

Sequence 1:NP_001355624.1 Gene:Ing4 / 28019 MGIID:107307 Length:249 Species:Mus musculus
Sequence 2:NP_001097359.1 Gene:MESR4 / 36986 FlyBaseID:FBgn0034240 Length:2171 Species:Drosophila melanogaster


Alignment Length:211 Identity:53/211 - (25%)
Similarity:67/211 - (31%) Gaps:88/211 - (41%)


- Green bases have known domain annotations that are detailed below.


Mouse   118 SSDYDSSSSKGKKKGRTQKEKK------------AARAR-------------------------- 144
            ||.:..|.|.|...|.::|..|            |.|.:                          
  Fly  1948 SSHHHHSHSNGGMAGSSRKRSKQRSLFGAGGSRPAKRHKPDPNDHLPPIPTLKIRPSLLPTTAPP 2012

Mouse   145 ---SKGKNSDEEA---------------PKAAQKKLKLVRTSPEYGMPSVT-FGSVHPSDVLD-- 188
               |:..:.||||               |......|.:....|....|:.| |....|..:|.  
  Fly  2013 SDSSESSSDDEEAEVNVTSVVPTPQPAPPPVLPTPLPVALPVPPPPPPAATAFNQPIPPALLPNP 2077

Mouse   189 --------------MPVDP---------NEPTYCLCH----QVSYGEMIGCDNPDCSIEWFHFAC 226
                          .|:.|         .|..||.|.    :||  |||.||..:|.||||||.|
  Fly  2078 GFATLQYFKANNIRYPIRPPAGARLAREGESVYCYCRCPYDEVS--EMIACDGDNCLIEWFHFEC 2140

Mouse   227 VGLTTKPRGKWFCPRC 242
            ||:...|:|||||..|
  Fly  2141 VGIMVAPQGKWFCAEC 2156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ing4NP_001355624.1 TNG2 7..245 CDD:227367 53/211 (25%)
ING_ING4 11..104 CDD:341095
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 115..163 16/100 (16%)
Bipartite nuclear localization signal. /evidence=ECO:0000250 127..148 7/61 (11%)
MESR4NP_001097359.1 C2H2 Zn finger 1272..1288 CDD:275368
C2H2 Zn finger 1295..1315 CDD:275370
C2H2 Zn finger 1323..1341 CDD:275370
PHD_ING 2110..2156 CDD:276980 26/47 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434088at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.