DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GNB3 and Gbeta5

DIOPT Version :9

Sequence 1:XP_011519255.1 Gene:GNB3 / 2784 HGNCID:4400 Length:360 Species:Homo sapiens
Sequence 2:NP_572452.1 Gene:Gbeta5 / 31744 FlyBaseID:FBgn0030011 Length:358 Species:Drosophila melanogaster


Alignment Length:306 Identity:153/306 - (50%)
Similarity:221/306 - (72%) Gaps:3/306 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     3 EMEQLRQEAEQLKKQIADARKACADVTLAELVSGLEVVGRVQMRTRRTLRGHLAKIYAMHWATDS 67
            :|..|.:|||.||.::.:.|:...||.|:.:...||.:..|.::.|:.|:||.||:....|:.|.
  Fly    18 KMASLVREAENLKTKLEEERQKLNDVNLSNIAERLEQIAYVNIKPRKVLKGHQAKVLCTDWSPDK 82

Human    68 KLLVSASQDGKLIVWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNMCSIYNLKSREGN 132
            :.::|:||||:||:||::||||.||:.:.::|:|.|||||||||||||||||..::|.:.|.|..
  Fly    83 RHIISSSQDGRLIIWDAFTTNKEHAVTMPTTWIMACAYAPSGNFVACGGLDNKVTVYPITSDEEM 147

Human   133 VKVSRELSAHTGYLSCCRFLD-DNNIVTSSGDTTCALWDIETGQQKTVFVGHTGDCMSLAVSPD- 195
            ....|.:..||.|:|||.:.: |..|:|.|||:||||||:|:||....|.||:||.|::.::|: 
  Fly   148 AAKKRTVGTHTSYMSCCIYPNSDQQILTGSGDSTCALWDVESGQLLQSFHGHSGDVMAIDLAPNE 212

Human   196 -FNLFISGACDASAKLWDVREGTCRQTFTGHESDINAICFFPNGEAICTGSDDASCRLFDLRADQ 259
             .|.|:||:||..|.:||:|.|...|:|.||:||:|::.|.|.|:||.|||||:||||:|:|||:
  Fly   213 TGNTFVSGSCDRMAFIWDMRSGHVVQSFEGHQSDVNSVKFHPCGDAIATGSDDSSCRLYDMRADR 277

Human   260 ELICFSHESIICGITSVAFSLSGRLLFAGYDDFNCNVWDSMKSERV 305
            |:..|:.||||.|:.||.||:|||||||||:|:..|:||::|||||
  Fly   278 EVAVFAKESIIFGVNSVDFSVSGRLLFAGYNDYTVNLWDTLKSERV 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GNB3XP_011519255.1 WD40 48..307 CDD:238121 139/261 (53%)
WD40 <49..307 CDD:225201 138/260 (53%)
WD40 repeat 58..95 CDD:293791 17/36 (47%)
WD40 repeat 101..141 CDD:293791 22/39 (56%)
WD40 repeat 146..181 CDD:293791 18/35 (51%)
WD40 repeat 188..223 CDD:293791 14/36 (39%)
WD40 repeat 229..265 CDD:293791 20/35 (57%)
WD40 repeat 273..318 CDD:293791 22/33 (67%)
Gbeta5NP_572452.1 WD40 62..358 CDD:238121 139/262 (53%)
WD40 repeat 73..110 CDD:293791 17/36 (47%)
WD40 repeat 116..156 CDD:293791 22/39 (56%)
WD40 repeat 161..197 CDD:293791 18/35 (51%)
WD40 repeat 204..241 CDD:293791 14/36 (39%)
WD40 repeat 247..283 CDD:293791 20/35 (57%)
WD40 repeat 291..327 CDD:293791 22/33 (67%)
WD40 repeat 333..357 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0286
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D313727at33208
OrthoFinder 1 1.000 - - FOG0000271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X182
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.