DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and CG17197

DIOPT Version :9

Sequence 1:NP_001365948.1 Gene:Zdhhc8 / 27801 MGIID:1338012 Length:775 Species:Mus musculus
Sequence 2:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster


Alignment Length:228 Identity:55/228 - (24%)
Similarity:86/228 - (37%) Gaps:67/228 - (29%)


- Green bases have known domain annotations that are detailed below.


Mouse     8 RLKPAKYIPVA-TAAALLVGSSTLFFV-----FTCP-------------WLTRAVSPAIPV-YNG 52
            |..|..::.:: ..|.|.|..:|:|||     :..|             ||.     ||.: || 
  Fly    13 RRNPKIFVRISHPTAVLFVIVTTIFFVVLQMFYVVPQLFDVQGFMYKLGWLV-----AIFITYN- 71

Mouse    53 ILFLFVLANFSMATFMDPGVFPRADEDEDKEDDFRAPLYKNVDVRGIQVRMKWCATCHFYRPPRC 117
             :|..:||....:|.::.  .|:..:..:.|::.               :..:|..|....|||.
  Fly    72 -IFGNMLACHITSTSVES--LPKDRQIPEPEEEH---------------QWHYCDVCEKLMPPRS 118

Mouse   118 SHCSVCDNCVEDFDHHCPWVNNCIGRRNYRYFFLFLLSLSAHMVGVVAFGLLYVLNHSEGLG--- 179
            .||.:|..|:...|.||.:..:|:|..|.||||.|.|.::.                  |.|   
  Fly   119 WHCILCKCCILKRDRHCIFTASCVGHNNQRYFFWFTLFMAL------------------GTGVAL 165

Mouse   180 AAHTTITMAVMCVAGLFF--IPVIGLTGFHVVL 210
            |.|...|:.....:.|.|  ||...|..|.:|:
  Fly   166 ATHIIATLKYFSYSDLIFLNIPRDNLPPFWLVI 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001365948.1 DHHC 99..224 CDD:396215 33/117 (28%)
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 14/61 (23%)
zf-DHHC 100..>198 CDD:279823 32/130 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.