DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and CG5196

DIOPT Version :9

Sequence 1:NP_001365948.1 Gene:Zdhhc8 / 27801 MGIID:1338012 Length:775 Species:Mus musculus
Sequence 2:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster


Alignment Length:227 Identity:69/227 - (30%)
Similarity:96/227 - (42%) Gaps:60/227 - (26%)


- Green bases have known domain annotations that are detailed below.


Mouse    54 LFLFVLA--NFSMATFMDPGVFPRADEDEDKED-DFRAPLYKNVDVRGIQVRMKWCATCHFYRPP 115
            |.|..||  |:.|||...||:.|:....:|.:| .|                :::|..|..|:.|
  Fly    54 LLLSTLATFNYVMATLTGPGLMPKQWHPKDPKDAQF----------------LQYCKKCEGYKAP 102

Mouse   116 RCSHCSVCDNCVEDFDHHCPWVNNCIGRRNYRYFFLFLL-SLSAHMVGVVAF------GL--LYV 171
            |..||..||.||:..||||||:|:|:|..|:.||..||| |:...:.|.|..      |:  .|.
  Fly   103 RSHHCRKCDRCVKKMDHHCPWINHCVGWANHAYFTYFLLFSILGSLQGTVVLCCSFWRGIYRYYY 167

Mouse   172 LNHSEGLGAAHT-----TITMAVMCV--AGLFFIPVIGL---------------TGFHVVLVTRG 214
            |.|    |.||.     |:...:||:  .||....||||               ||..:.:|.:.
  Fly   168 LTH----GLAHLASVQFTLLSIIMCILGMGLAIGVVIGLSMLLFIQLKTIVNNQTGIEIWIVEKA 228

Mouse   215 ---RTTNEQVTGKFRGGVNPFTRGCYGNVEHV 243
               |..|.....:|   :.|:..|...|:..|
  Fly   229 IYRRYRNADCDDEF---LYPYDLGWRANLRLV 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001365948.1 DHHC 99..224 CDD:396215 50/158 (32%)
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 48/153 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.