DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GNAS and Galphaq

DIOPT Version :9

Sequence 1:XP_016883301.1 Gene:GNAS / 2778 HGNCID:4392 Length:1038 Species:Homo sapiens
Sequence 2:NP_725192.2 Gene:Galphaq / 36384 FlyBaseID:FBgn0004435 Length:396 Species:Drosophila melanogaster


Alignment Length:432 Identity:154/432 - (35%)
Similarity:228/432 - (52%) Gaps:92/432 - (21%)


- Green bases have known domain annotations that are detailed below.


Human   654 EKRAQKRAEKKRSKLIDKQLQDEKMGYMCTHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEE 718
            |.:.|||..::    |:|||:.:|.......:|||||.|||||||.:|||||:|.:|::.|    
  Fly     8 EAKEQKRINQE----IEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDE---- 64

Human   719 DPQAARSNSDGSEKATKVQDIKNNLKEAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPD 783
                        :|...::.:..|:..|:::::.||..|  .:.....|:....|.::|:    |
  Fly    65 ------------DKRGYIKLVFQNIFMAMQSMIKAMDML--KISYGQGEHSELADLVMSI----D 111

Human   784 FD----FPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDKID----------------- 827
            ::    |...:....|.||:|.|::.||:|..||||.|.|:|:|..:|                 
  Fly   112 YETVTTFEDPYLNAIKTLWDDAGIQECYDRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRV 176

Human   828 --------------------------VIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMF 866
                                      .|:||||:|::||:||.||.|:||.|..|.:|.:.|.|.
  Fly   177 RVPTTGIIEYPFDLEEIRFSYLSDLARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRMV 241

Human   867 DVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISV 931
            ||||||.||||||.||.:||:|||:||.|.|:.::.|.:..||::|:..||::|....|.:..||
  Fly   242 DVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSV 306

Human   932 ILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPE-DATPEPGEDPRVTRAKYFIRDEFLRISTA 995
            ||||||:|||.||::  .|.:.|||||   |..|: ||         :| |:.||...|:.::. 
  Fly   307 ILFLNKKDLLEEKIM--YSHLVDYFPE---YDGPQRDA---------IT-AREFILRMFVDLNP- 355

Human   996 SGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYEL 1037
              |.....|.|||||.|||||:.||...:|.|.:..|:::.|
  Fly   356 --DSEKIIYSHFTCATDTENIKLVFCAVKDTIMQNALKEFNL 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GNASXP_016883301.1 None
GalphaqNP_725192.2 G-alpha 34..390 CDD:206639 143/395 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.