DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GNAL and Galphao

DIOPT Version :9

Sequence 1:NP_892023.1 Gene:GNAL / 2774 HGNCID:4388 Length:458 Species:Homo sapiens
Sequence 2:NP_523684.2 Gene:Galphao / 36104 FlyBaseID:FBgn0001122 Length:354 Species:Drosophila melanogaster


Alignment Length:374 Identity:166/374 - (44%)
Similarity:225/374 - (60%) Gaps:32/374 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    82 SAEEREAAKEREAVKEARKVSRGIDRMLRDQKRDLQQTHRLLLLGAGESGKSTIVKQMRILHVNG 146
            |||||.||        ||  ||.|:|.|::......:..:||||||||||||||||||:|:|.:|
  Fly     6 SAEERAAA--------AR--SRLIERNLKEDGIQAAKDIKLLLLGAGESGKSTIVKQMKIIHESG 60

Human   147 FNPEEKKQKILDIRKNVKDAIVTIVSAMSTIIPPVPLANPENQFRSDYIKSIAP-ITDFE-YSQE 209
            |..|:.||....:..|...::|.|:.||.|:  .:..:|.|.:..:..:..:.. :.|.| :|:|
  Fly    61 FTAEDFKQYRPVVYSNTIQSLVAILRAMPTL--SIQYSNNERESDAKMVFDVCQRMHDTEPFSEE 123

Human   210 FFDHVKKLWDDEGVKACFERSNEYQLIDCAQYFLERIDSVSLVDYTPTDQDLLRCRVLTSGIFET 274
            ....:|:||.|.||:.||.|||||||.|.|:|||:.:|.:...||.||:||:||.||.|:||.|.
  Fly   124 LLAAMKRLWQDAGVQECFSRSNEYQLNDSAKYFLDDLDRLGAKDYQPTEQDILRTRVKTTGIVEV 188

Human   275 RFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIYVAACSSYNMVIREDNNTNRLRESLDLFES 339
            .|....:||.:|||||||.||:|||.||.||||||:..|.|.|:.|:.||..|||::|||.||:|
  Fly   189 HFSFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDS 253

Human   340 IWNNRWLRTISIILFLNKQDMLAEKVLAGKSKIEDYFPEYANYTVPEDATPDAGEDPKVTRAKFF 404
            |.||:|....||||||||:|:..||:  .||.:...||||.       ...:.||.....:|:|.
  Fly   254 ICNNKWFTDTSIILFLNKKDLFEEKI--RKSPLTICFPEYT-------GGQEYGEAAAYIQAQFE 309

Human   405 IRDLFLRISTATGDGKHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLK 453
            .::.    ||:.   :.||  |.|||.||.||:.||:...|:|...:|:
  Fly   310 AKNK----STSK---EIYC--HMTCATDTNNIQFVFDAVTDVIIANNLR 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GNALNP_892023.1 G_alpha 99..455 CDD:214595 158/357 (44%)
G-alpha 120..452 CDD:206639 151/333 (45%)
GalphaoNP_523684.2 G-alpha 34..348 CDD:206639 151/333 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.