DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam4 and IGDCC3

DIOPT Version :10

Sequence 1:NP_001261571.1 Gene:Dscam4 / 2769008 FlyBaseID:FBgn0263219 Length:1935 Species:Drosophila melanogaster
Sequence 2:NP_004875.2 Gene:IGDCC3 / 9543 HGNCID:9700 Length:814 Species:Homo sapiens


Alignment Length:732 Identity:168/732 - (22%)
Similarity:263/732 - (35%) Gaps:191/732 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   508 VSHSAKVNIYGLPYIREMPKITGISGSDLIVKCPVAGYPIDKIHWERDGQTLPINRRQRAYNNGT 572
            :.|||:     |.:..|......:.|..:::.|.|.|.|..:|.|.::|..||.:.......||:
Human    36 LGHSAE-----LAFAVEPSDDVAVPGQPIVLDCRVEGTPPVRITWRKNGVELPESTHSTLLANGS 95

  Fly   573 LIIEQLQRLE------DAGTYTCMAQNKQKQTSRRNVEIQVLVPPKIMPIQAMTNMLREGMRAAI 631
            |:|... |||      |.|.|.|:|||:......|...||...... ..:.....:..||..|..
Human    96 LMIRHF-RLEPGGSPSDEGDYECVAQNRFGLVVSRKARIQAATMSD-FHVHPQATVGEEGGVARF 158

  Fly   632 SCQILEGDLPVSFRWERNGKPLIGTGNEVFRRLDEYSASLVIEHISSDHSGNYTCIASNVAGTE- 695
            .|||.....|: ..||:|..| |.|.||.:..|.:  ..|.|..:.::..|.:.|:|||:|... 
Human   159 QCQIHGLPKPL-ITWEKNRVP-IDTDNERYTLLPK--GVLQITGLRAEDGGIFHCVASNIASIRI 219

  Fly   696 ----RFTVPLT---VNVPPKWILEPKDSSAQAGADVLLHCQSSGYPTPTITWKKAIGPTPGEYKD 753
                |.||..:   ....|..::.|::.:.......:|.|.::|.|.|.::|.:..|...|    
Human   220 SHGARLTVSGSGSGAYKEPAILVGPENLTLTVHQTAVLECVATGNPRPIVSWSRLDGRPIG---- 280

  Fly   754 FLYEPTVQLFPNGTIFFKKISKESQGHFLCEAKNNIGSGVSKVI--FLKVNVPAHFQTKTKQISV 816
               ...:|:...|.:....::.:..|.::| |.|..|:.|.:..  .|.|..||.|....:.||.
Human   281 ---VEGIQVLGTGNLIISDVTVQHSGVYVC-AANRPGTRVRRTAQGRLVVQAPAEFVQHPQSISR 341

  Fly   817 AKGKQVHVQCNVQGDNPIDFKWKIQATQQYLDESLDSRYTIRDQVLDDGMV-------------S 868
            ..|......|..||:.|....|                       |.:|.|             |
Human   342 PAGTTAMFTCQAQGEPPPHVTW-----------------------LKNGQVLGPGGHVRLKNNNS 383

  Fly   869 ELGISHTYRQDTGIYICQASNAFGQDEMSIQLIV---QEVPEQPKNLRINSQQSRSLQLTWSQPF 930
            .|.||....:|..||.|.|.|:.|..:.|.:|.|   :.:|..|:|:|..|..|..::::||:|.
Human   384 TLTISGIGPEDEAIYQCVAENSAGSSQASARLTVLWAEGLPGPPRNVRAVSVSSTEVRVSWSEPL 448

  Fly   931 AGNSPIEEYHIYYKQISDIWQNAEHLTIAGAQTVINIQQLRPAKAYHIRMSAENKLGASEFSEVV 995
            |....|..|                                   ..|||.:|:..  ..|:.|.|
Human   449 ANTKEIIGY-----------------------------------VLHIRKAADPP--ELEYQEAV 476

  Fly   996 QVTTLEEVPSGPPLAVRAEPKSSTEIFVTWDAPERDHWNGILLGYYVGYQMSLTPEDKEVNPTQG 1060
            ..:|.:.:.|                                                ::.|:..
Human   477 SKSTFQHLVS------------------------------------------------DLEPSTA 493

  Fly  1061 FSFKTVEVRSHFGGETVLANLNKFTQYHVIVQAYTSQGSGPPSKEIAVQTMEDVPSSPPESPQCD 1125
            :||                          .::|||.:|:...|......|:.:.|:.||.|.:  
Human   494 YSF--------------------------YIKAYTPRGASSASVPTLASTLGEAPAPPPLSVR-- 530

  Fly  1126 VLGSTSIYITWSP-PDIDGQNGKIKGYKVFYISVDELYETDPEVVKSTNQYVTIENLRKYTNYTV 1189
            ||||:|:.:.|.| |.:....|   |:|:||....:...|.|.::..|.....:..|.....|.|
Human   531 VLGSSSLQLLWEPWPRLAQHEG---GFKLFYRPASKTSFTGPILLPGTVSSYNLSQLDPTAVYEV 592

  Fly  1190 WVLAYTKVGDGMKTKPF 1206
            .:|||.:.|||..|..|
Human   593 KLLAYNQHGDGNATVRF 609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam4NP_001261571.1 Ig 31..124 CDD:472250
Ig strand B 50..54 CDD:409353
Ig strand C 63..66 CDD:409353
Ig strand E 82..86 CDD:409353
Ig strand F 102..107 CDD:409353
Ig strand G 115..119 CDD:409353
Ig 235..326 CDD:472250
Ig strand B 253..257 CDD:409353
Ig strand C 266..270 CDD:409353
Ig strand E 292..296 CDD:409353
Ig strand F 306..311 CDD:409353
Ig strand G 319..322 CDD:409353
IgC2_3_Dscam 329..417 CDD:409549
Ig strand A 330..335 CDD:409549
Ig strand A' 338..342 CDD:409549
Ig strand B 345..355 CDD:409549
Ig strand C 360..366 CDD:409549
Ig strand C' 367..370 CDD:409549
Ig strand E 383..389 CDD:409549
Ig strand F 396..404 CDD:409549
Ig strand G 407..417 CDD:409549
IgI_4_Dscam 422..516 CDD:409548 3/7 (43%)
Ig strand A' 430..434 CDD:409548
Ig strand B 437..446 CDD:409548
Ig strand C 451..457 CDD:409548
Ig strand C' 459..462 CDD:409548
Ig strand D 467..475 CDD:409548
Ig strand E 479..488 CDD:409548
Ig strand F 495..503 CDD:409548
Ig strand G 506..516 CDD:409548 3/7 (43%)
IgI_5_Dscam 520..607 CDD:409550 27/92 (29%)
Ig strand A 520..522 CDD:409550 0/1 (0%)
Ig strand A' 527..531 CDD:409550 0/3 (0%)
Ig strand B 534..541 CDD:409550 0/6 (0%)
Ig strand C 548..554 CDD:409550 2/5 (40%)
Ig strand C' 555..557 CDD:409550 0/1 (0%)
Ig strand D 564..568 CDD:409550 0/3 (0%)
Ig strand E 571..577 CDD:409550 3/5 (60%)
Ig strand F 585..593 CDD:409550 4/7 (57%)
Ig strand G 597..607 CDD:409550 2/9 (22%)
Ig 610..703 CDD:472250 27/100 (27%)
Ig strand B 629..633 CDD:409353 1/3 (33%)
Ig strand C 643..647 CDD:409353 0/3 (0%)
Ig strand E 669..673 CDD:409353 1/3 (33%)
Ig strand F 683..688 CDD:409353 1/4 (25%)
Ig strand G 696..699 CDD:409353 1/2 (50%)
IgI_7_Dscam 706..801 CDD:409546 19/96 (20%)
Ig strand A 706..710 CDD:409546 1/3 (33%)
Ig strand A' 715..719 CDD:409546 0/3 (0%)
Ig strand B 722..731 CDD:409546 2/8 (25%)
Ig strand C 737..743 CDD:409546 1/5 (20%)
Ig strand C' 749..752 CDD:409546 1/2 (50%)
Ig strand D 760..763 CDD:409546 1/2 (50%)
Ig strand E 766..772 CDD:409546 1/5 (20%)
Ig strand F 779..787 CDD:409546 3/7 (43%)
Ig strand G 792..801 CDD:409546 2/10 (20%)
Ig 804..889 CDD:472250 23/97 (24%)
Ig strand B 822..826 CDD:409353 0/3 (0%)
Ig strand C 835..839 CDD:409353 0/3 (0%)
FN3 <850..1254 CDD:442628 78/374 (21%)
Ig strand F 882..887 CDD:409353 3/4 (75%)
FN3 906..999 CDD:238020 19/92 (21%)
fn3 1117..1203 CDD:394996 28/86 (33%)
FN3 1185..>1580 CDD:442628 10/22 (45%)
FN3 1405..1494 CDD:238020
IGDCC3NP_004875.2 Ig 41..135 CDD:472250 28/99 (28%)
Ig strand B 59..63 CDD:409353 0/3 (0%)
Ig strand C 72..76 CDD:409353 1/3 (33%)
Ig strand E 94..98 CDD:409353 2/3 (67%)
Ig strand F 114..119 CDD:409353 2/4 (50%)
Ig strand G 128..131 CDD:409353 1/2 (50%)
Ig 143..227 CDD:472250 25/87 (29%)
Ig strand B 156..160 CDD:409353 1/3 (33%)
Ig strand C 169..173 CDD:409353 0/4 (0%)
Ig strand E 192..196 CDD:409353 1/3 (33%)
Ig strand F 206..211 CDD:409353 1/4 (25%)
Ig strand G 220..223 CDD:409353 0/2 (0%)
Ig_3 238..310 CDD:464046 15/79 (19%)
I-set 331..417 CDD:400151 25/108 (23%)
Ig strand B 347..351 CDD:409353 0/3 (0%)
Ig strand C 360..364 CDD:409353 1/26 (4%)
FN3 <371..>624 CDD:442628 75/355 (21%)
Ig strand E 381..387 CDD:409353 2/5 (40%)
Ig strand F 397..402 CDD:409353 3/4 (75%)
Ig strand G 410..413 CDD:409353 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 722..743
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 762..814
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.