DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam4 and Robo2

DIOPT Version :10

Sequence 1:NP_001261571.1 Gene:Dscam4 / 2769008 FlyBaseID:FBgn0263219 Length:1935 Species:Drosophila melanogaster
Sequence 2:XP_038944599.1 Gene:Robo2 / 84409 RGDID:620167 Length:1625 Species:Rattus norvegicus


Alignment Length:1764 Identity:372/1764 - (21%)
Similarity:607/1764 - (34%) Gaps:475/1764 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   413 AELQLGDASPELLYWFSEQTLQPGPTVSLKCVATGNPLPQFTWSLDGFPI------PDSSRFLV- 470
            :.|:..|..|.::...|:..:..|...:|.|.|.|.|.|...|..||..:      |.|.|.|: 
  Rat    45 SRLRQEDFPPRIVEHPSDVIVSKGEPTTLNCKAEGRPTPTIEWYKDGERVETDKDDPRSHRMLLP 109

  Fly   471 -GQYVTIHDDVISHVNISNVKEEDGGEYTCTAQNAIGK-VSHSAKVNIYGL-PYIREMP-KITGI 531
             |....:.   |.|...|   :.|.|.|.|.|:|.:|: ||.:|.:.:..| ...|:.| .:...
  Rat   110 SGSLFFLR---IVHGRRS---KPDEGTYVCVARNYLGEAVSRNASLEVALLRDDFRQNPTDVVVA 168

  Fly   532 SGSDLIVKC-PVAGYPIDKIHWERDGQTLPINRRQRAYNNGTLIIEQLQRLEDAGTYTCMAQNKQ 595
            :|...|::| |..|:|...|:|::|...:.....:.:...|.|:|.. .|..|||.|||:..|..
  Rat   169 AGEPAILECQPPRGHPEPTIYWKKDKVRIDEKEERISIRGGKLMISN-TRKSDAGMYTCVGTNMV 232

  Fly   596 KQTSRRNVEIQVLVPPKIM--PIQAMTNMLREGMRAAISCQILEGDLPVSFRWERNGKPLIGTGN 658
            .:......|:.|...|..:  ||   ..::.|...|...||: :||...:.||:::...|.....
  Rat   233 GERDSDPAELTVFERPTFLRRPI---NQVVLEDEPAEFRCQV-QGDPQPTVRWKKDDADLPRGRY 293

  Fly   659 EVFRRLDEYSASLVIEHISSDHSGNYTCIASNVAGTERFTVPLTVNV----PPKWILEPKDSSAQ 719
            ::   .|:|  :|.|:...|...|.|.|||.|..|....:..|||.|    ||::::.|:|....
  Rat   294 DI---KDDY--TLRIKKAISADEGTYVCIAENRVGKVEASATLTVRVRPVAPPQFVVRPRDQIVA 353

  Fly   720 AGADVLLHCQSSGYPTPTITWKKAIGPTPGEYKDFLYEPT--------VQLFPNGTIFFKKISKE 776
            .|..|...|::.|.|.|.:.|:|       |....|..|.        ..:.|.|.:....|.:.
  Rat   354 QGRTVTFPCETKGNPQPAVFWQK-------EGSQNLLFPNQPQQPNSRCSVSPTGDLTITNIQRS 411

  Fly   777 SQGHFLCEAKNNIGSGVSKVIFLKVNV------PAHFQTKTKQISVAKGKQVHVQCNVQGDNPID 835
            ..|:::|:|....||.::|......:|      |...|....|.....|..: ::|...|:....
  Rat   412 DAGYYICQALTVAGSILAKAQLEVTDVLTDRPPPIILQGPINQTLAVDGTAL-LKCKATGEPLPV 475

  Fly   836 FKWKIQATQQYLDESL-----DSRYTIRDQVLDDGMVSELGISHTYRQDTGIYICQASNAFGQDE 895
            ..|        |.|..     |.|.||:||       ..|.|.:....|||.|.|.|:::.|:..
  Rat   476 ISW--------LKEGFTFLGRDPRATIQDQ-------GTLQIKNLRISDTGTYTCVATSSSGETS 525

  Fly   896 MSIQLIVQE-------------VPEQPKNLRINSQQSRSLQLTWSQPFAGNSPIEEYHI--YYKQ 945
            .|..|.|.|             :|..|...::......|:.|:|.....|..|...|.|  :.:.
  Rat   526 WSAVLDVTESGATISKNYDTNDLPGPPSKPQVTDVTKNSVTLSWQPGTPGVLPASAYIIEAFSQS 590

  Fly   946 ISDIWQN-AEHLTIAGAQTVINIQQLRPAKAYHIRMSAENKLGASEFSEVVQVTTLEEVPSGPP- 1008
            :|:.||. |.|:    ..|:..::.|||...|...:.|.|..|.|:.|.:......:::  .|| 
  Rat   591 VSNSWQTVANHV----KTTLYTVRGLRPNTIYLFMVRAINPQGLSDPSPMSDPVRTQDI--SPPA 649

  Fly  1009 --------------LAVRAEPK---SSTEIFVTWDAPERDHWNGILLGYYVGYQMSLTPEDKEVN 1056
                          :.||....   :.|.:.|||..   |.....:.||.|.|:.          
  Rat   650 QGVDHRQVQKELGDVTVRLHNPVVLTPTTVQVTWTV---DRQPQFIQGYRVMYRQ---------- 701

  Fly  1057 PTQGFSFKTV----EVRSHFGGETVLANLNKFTQYHVIVQAYTSQGSGPPSKEIAVQTMEDVPSS 1117
             |.|....||    :.:.......||.||.|...|.:.|:.|.::..|..|:...::|.|:.||:
  Rat   702 -TSGLQASTVWQNLDAKVPTERSAVLVNLKKGVTYEIKVRPYFNEFQGMDSESKTIRTTEEAPSA 765

  Fly  1118 PPESPQCDVLG---STSIYITWSPPDIDGQNGKIKGYKVFYISVDELYETDPEVVKSTNQYVTIE 1179
            ||:|.....:|   ||||.::|.||..|.|||.|:.||::.:..:..:..: :.|.:|.:.|.|.
  Rat   766 PPQSVTVLTVGSHNSTSISVSWDPPPADHQNGIIQEYKIWCLGNETRFHIN-KTVDATIRSVVIG 829

  Fly  1180 NLRKYTNYTVWVLAYTKVGDGMKTKP------------------FYCRTHEDVPSAPQAIKAIPA 1226
            .|.....|.|.|.|.|..|.|:|::|                  .......||...|..|..|..
  Rat   830 GLFPGIQYRVEVAASTSAGVGVKSEPQPIIIGGRNEVVITENNNSITEQITDVVKQPAFIAGIGG 894

  Fly  1227 SSSKIIIS---WL------PPDLPNGDITGYTFYMSMLEGG-REEGTHKRLLGPFVEMHETVRTQ 1281
            :...|::.   ||      ...|.|     |.......:|| ...|:...||           ..
  Rat   895 ACWVILMGFSIWLYWRRKKRKGLSN-----YAVTFQRGDGGLMSNGSRPGLL-----------NT 943

  Fly  1282 ESATYQFWLTASTKMGEGEKTQVVTVPPN--NKVPARIVSFSQ-----RIVTPWKEH-------- 1331
            ...:|. ||        .:.....::|.|  |..|..|.:|.:     .:.....||        
  Rat   944 GDPSYP-WL--------ADSWPATSLPVNNSNSGPNEIGNFGRGDFKHNVNKNLAEHGIKKEFLG 999

  Fly  1332 LELPCRKVGAPAPVTIWRQDGHNMETSARKTIAKNGTLYMKECQASDAGNYTCSVENTWGKDEIV 1396
            :|.....|..|.|       |...:|:   |:..:|.:|             .|::.|   .:..
  Rat  1000 MERNKNDVLPPVP-------GQGDKTA---TMLSDGAIY-------------SSIDFT---TKTT 1038

  Fly  1397 YNIVVKVPPEAPNLTVINAYTDSLL--------LEWMDNSHGGSPILGYVINYKRDNGDWEELQV 1453
            ||...::....|..|....:::|:.        .:|..:....|.::|:..:....|.       
  Rat  1039 YNSSSQITQATPYATTQILHSNSIHELAVDLPDPQWKSSVQQKSDLMGFAYSLPDQNK------- 1096

  Fly  1454 DSKTTSHLLTNLWCGTRYQLYITAYNKIGTGLPCDIVNSYT---------------------KGN 1497
                          |....|||..| ::..||...:.::.:                     ||.
  Rat  1097 --------------GNNALLYIPDY-RLAEGLSNRMPHNQSQDFSTTSSHNSSERSGSLSGGKGG 1146

  Fly  1498 PPVQPKHSQMITNNSTSVTCWLDSWGD-----------GGCGILYFMIE-SRVYGRSSWA---VV 1547
            ...:.|:|.....|:.|      :|.:           .|..:.::..| ...|...||.   .|
  Rat  1147 KKKKTKNSSKAQKNNGS------TWANVPLPPPPVQPLPGTELGHYPAEQENGYDSDSWCPPLPV 1205

  Fly  1548 SNHI-----------------PPTERI----------YTVSDLVPGTKYQLKVTAHNNAGSTTAI 1585
            ..::                 ||...:          .:.:.|.|..:.:::.....:....|..
  Rat  1206 QTYLHQGMEDELEEDEDRVPTPPVRGVASSPAISFGQQSTATLTPSPREEMQPMLQAHLDELTRA 1270

  Fly  1586 YNFTTLSTQGVIYNN--DHSTPVSHLSDLPFYANFKLL--------------------LPICFSL 1628
            |.|........|.:|  ....||..|.    ||:..|:                    :|     
  Rat  1271 YQFDIAKQTWHIQSNTPPPQPPVPPLG----YASGALISDLETDVPDEDADDEEEPLEIP----- 1326

  Fly  1629 LMLLALIGAALFLRKRKLASQARLASSSM-----SESPSLAN-LQNKQNRDQQYLAVRCNPGTSA 1687
                           |.|.:..:...|||     |.:.|:.| ..:..:.|:.:.:.|.:.|:|:
  Rat  1327 ---------------RPLRALDQTPGSSMDNLDSSVTGSMVNGWGSASDEDRNFSSHRSSVGSSS 1376

  Fly  1688 PRGSNSNDSGSFGKAEGNEYIEDICPYATFQLNKQTYSESSYSGNVYSGPYHSVRGSFVYHDVKP 1752
              ..:...||||.:|     :......|.|:|:..:.:.   :|..::.....          :|
  Rat  1377 --DGSIFASGSFAQA-----LVAAADKAGFRLDGTSLTR---TGKAFTSSQRQ----------RP 1421

  Fly  1753 ES------------YHSKEPEYTKVRRKVGRLRDP------HSESQESDNPGSTDSEVRKILTLH 1799
            .|            ..|:.|..|| :.|.||: ||      ..|....|.|...|....:.|...
  Rat  1422 TSPFSTDSNTSAAQNQSQRPRPTK-KHKGGRM-DPQPVLPHRREGMPDDLPPPPDPPPGQGLRQQ 1484

  Fly  1800 IPITEY--------DTLGSESDNDVSARALNSAK----------YRAQRDTQDETSSSSETTPT- 1845
            |.::::        :..||..:...:|. |...|          ...|..|||..:|:.....| 
  Rat  1485 IGLSQHSGNVESSTERKGSSLERQQAAN-LEDTKSSLDCPAKTTVEWQHQTQDWINSTERQEETR 1548

  Fly  1846 ------------SMTRKSKPPFAARKG-------GKPGTSGKR--------HVRSSS-----GYS 1878
                        |:...|||.|.:..|       ...|::|.|        |.|:::     ||.
  Rat  1549 KAPHKPGVGSEESLVPYSKPSFPSPGGHSSSGTASSKGSTGPRKAEILRGSHQRNANDLLDIGYV 1613

  Fly  1879 SHNEETTFS 1887
            ..|.:..|:
  Rat  1614 GSNSQGQFT 1622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam4NP_001261571.1 Ig 31..124 CDD:472250
Ig strand B 50..54 CDD:409353
Ig strand C 63..66 CDD:409353
Ig strand E 82..86 CDD:409353
Ig strand F 102..107 CDD:409353
Ig strand G 115..119 CDD:409353
Ig 235..326 CDD:472250
Ig strand B 253..257 CDD:409353
Ig strand C 266..270 CDD:409353
Ig strand E 292..296 CDD:409353
Ig strand F 306..311 CDD:409353
Ig strand G 319..322 CDD:409353
IgC2_3_Dscam 329..417 CDD:409549 1/3 (33%)
Ig strand A 330..335 CDD:409549
Ig strand A' 338..342 CDD:409549
Ig strand B 345..355 CDD:409549
Ig strand C 360..366 CDD:409549
Ig strand C' 367..370 CDD:409549
Ig strand E 383..389 CDD:409549
Ig strand F 396..404 CDD:409549
Ig strand G 407..417 CDD:409549 1/3 (33%)
IgI_4_Dscam 422..516 CDD:409548 30/102 (29%)
Ig strand A' 430..434 CDD:409548 0/3 (0%)
Ig strand B 437..446 CDD:409548 2/8 (25%)
Ig strand C 451..457 CDD:409548 2/5 (40%)
Ig strand C' 459..462 CDD:409548 1/2 (50%)
Ig strand D 467..475 CDD:409548 3/9 (33%)
Ig strand E 479..488 CDD:409548 2/8 (25%)
Ig strand F 495..503 CDD:409548 4/7 (57%)
Ig strand G 506..516 CDD:409548 4/10 (40%)
IgI_5_Dscam 520..607 CDD:409550 23/88 (26%)
Ig strand A 520..522 CDD:409550 0/1 (0%)
Ig strand A' 527..531 CDD:409550 0/3 (0%)
Ig strand B 534..541 CDD:409550 2/7 (29%)
Ig strand C 548..554 CDD:409550 2/5 (40%)
Ig strand C' 555..557 CDD:409550 1/1 (100%)
Ig strand D 564..568 CDD:409550 0/3 (0%)
Ig strand E 571..577 CDD:409550 3/5 (60%)
Ig strand F 585..593 CDD:409550 4/7 (57%)
Ig strand G 597..607 CDD:409550 1/9 (11%)
Ig 610..703 CDD:472250 25/94 (27%)
Ig strand B 629..633 CDD:409353 1/3 (33%)
Ig strand C 643..647 CDD:409353 1/3 (33%)
Ig strand E 669..673 CDD:409353 1/3 (33%)
Ig strand F 683..688 CDD:409353 2/4 (50%)
Ig strand G 696..699 CDD:409353 0/2 (0%)
IgI_7_Dscam 706..801 CDD:409546 24/102 (24%)
Ig strand A 706..710 CDD:409546 2/3 (67%)
Ig strand A' 715..719 CDD:409546 1/3 (33%)
Ig strand B 722..731 CDD:409546 2/8 (25%)
Ig strand C 737..743 CDD:409546 1/5 (20%)
Ig strand C' 749..752 CDD:409546 1/2 (50%)
Ig strand D 760..763 CDD:409546 0/2 (0%)
Ig strand E 766..772 CDD:409546 1/5 (20%)
Ig strand F 779..787 CDD:409546 3/7 (43%)
Ig strand G 792..801 CDD:409546 1/8 (13%)
Ig 804..889 CDD:472250 23/89 (26%)
Ig strand B 822..826 CDD:409353 0/3 (0%)
Ig strand C 835..839 CDD:409353 0/3 (0%)
FN3 <850..1254 CDD:442628 117/476 (25%)
Ig strand F 882..887 CDD:409353 2/4 (50%)
FN3 906..999 CDD:238020 24/95 (25%)
fn3 1117..1203 CDD:394996 30/88 (34%)
FN3 1185..>1580 CDD:442628 80/508 (16%)
FN3 1405..1494 CDD:238020 14/96 (15%)
Robo2XP_038944599.1 IgC_1_Robo 54..152 CDD:409490 30/103 (29%)
Ig strand A 54..58 CDD:409490 1/3 (33%)
Ig strand A' 61..66 CDD:409490 1/4 (25%)
Ig strand B 70..78 CDD:409490 2/7 (29%)
Ig strand C 84..89 CDD:409490 1/4 (25%)
Ig strand C' 92..94 CDD:409490 0/1 (0%)
Ig strand D 105..108 CDD:409490 1/2 (50%)
Ig strand E 111..117 CDD:409490 1/5 (20%)
Ig strand F 129..137 CDD:409490 4/7 (57%)
Ig strand G 140..152 CDD:409490 4/11 (36%)
Ig 159..244 CDD:472250 23/85 (27%)
Ig strand B 173..177 CDD:409353 1/3 (33%)
Ig strand C 187..191 CDD:409353 1/3 (33%)
Ig strand E 209..213 CDD:409353 2/3 (67%)
Ig strand F 223..228 CDD:409353 3/4 (75%)
Ig strand G 237..240 CDD:409353 0/2 (0%)
Ig 251..333 CDD:472250 24/90 (27%)
Ig strand B 265..269 CDD:409353 1/3 (33%)
Ig strand C 278..282 CDD:409353 1/3 (33%)
Ig strand E 299..303 CDD:409353 2/5 (40%)
Ig strand F 313..318 CDD:409353 2/4 (50%)
Ig strand G 326..329 CDD:409353 0/2 (0%)
IgI_4_Robo 342..439 CDD:409391 22/103 (21%)
Ig strand A 342..346 CDD:409391 0/3 (0%)
Ig strand A' 348..352 CDD:409391 1/3 (33%)
Ig strand B 358..366 CDD:409391 2/7 (29%)
Ig strand C 369..376 CDD:409391 2/6 (33%)
Ig strand C' 378..381 CDD:409391 0/2 (0%)
Ig strand D 394..399 CDD:409391 0/4 (0%)
Ig strand E 401..408 CDD:409391 1/6 (17%)
Ig strand F 414..423 CDD:409391 3/8 (38%)
Ig strand G 425..436 CDD:409391 3/10 (30%)
IgI_5_Robo 446..532 CDD:409544 25/101 (25%)
Ig strand A 446..449 CDD:409544 0/2 (0%)
Ig strand A' 453..456 CDD:409544 1/2 (50%)
Ig strand B 462..469 CDD:409544 1/7 (14%)
Ig strand C 475..480 CDD:409544 1/12 (8%)
Ig strand C' 482..484 CDD:409544 0/1 (0%)
Ig strand D 491..495 CDD:409544 2/3 (67%)
Ig strand E 498..503 CDD:409544 1/4 (25%)
FN3 <510..882 CDD:442628 97/392 (25%)
Ig strand F 511..519 CDD:409544 4/7 (57%)
Ig strand G 522..532 CDD:409544 3/9 (33%)
FN3 549..642 CDD:238020 24/96 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.