DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam4 and Kirrel3

DIOPT Version :10

Sequence 1:NP_001261571.1 Gene:Dscam4 / 2769008 FlyBaseID:FBgn0263219 Length:1935 Species:Drosophila melanogaster
Sequence 2:NP_001420714.1 Gene:Kirrel3 / 67703 MGIID:1914953 Length:803 Species:Mus musculus


Alignment Length:841 Identity:184/841 - (21%)
Similarity:290/841 - (34%) Gaps:230/841 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   425 LYWFS----EQTLQPGPTVSLKCVATGNPLPQFTWSLDGFP--IPDSSRFLVG-------QYVTI 476
            :|.||    :|.:..|..|:|.|.     :|::    |||.  |.|.....||       ||:.:
Mouse    47 VYSFSQQPQDQVVVSGQPVTLLCA-----IPEY----DGFVLWIKDGLALGVGRDLSSYPQYLVV 102

  Fly   477 --HDDVISHVNISNVKEEDGGEYTCTA-QNAIGKVSHSAKVNIY---GLPYIREMPKITGISGSD 535
              |.....|:.|...:.:|...|.|.| |.||.  |..|::.:.   ..|.|...|.|:..:|..
Mouse   103 GNHLSGEHHLKILRAELQDDAVYECQAIQAAIR--SRPARLTVLVPPDDPIILGGPVISLRAGDP 165

  Fly   536 LIVKCPV-AGYPIDKIHWERDGQTLPINRRQRAYNNGTLIIEQLQR-----------------LE 582
            |.:.|.. ...|...|.|.|.|:.:          ||....:.|.|                 :|
Mouse   166 LNLTCHADNAKPAASIIWLRKGEVI----------NGATYSKTLLRDGKRESIVSTLFISPGDVE 220

  Fly   583 DAGTYTCMAQNKQ----KQTSRRNVEIQVLVPPKIMPIQAMTNMLREGMRAAISCQILEGDLPVS 643
            :..:..|.|.||.    |:||   |.|.:..|| ::.:......:.|.......|..........
Mouse   221 NGQSIVCRATNKAIPGGKETS---VTIDIQHPP-LVNLSVEPQPVLEDNIVTFHCSAKANPAVTQ 281

  Fly   644 FRWERNGKPLIGTGNEVFRRLDEYSASLVIEHISSDHSGNYTCIASNVAGTERFTVPLTVNVPPK 708
            :||.:.|..:.....|::|...:|:.          .|...:|..:|..|:...:..:.|...|:
Mouse   282 YRWAKRGHIIKEASGELYRTTVDYTY----------FSEPVSCEVTNALGSTNLSRTVDVYFGPR 336

  Fly   709 WILEPKDSSAQAGADVLLHCQSSGYPTPTITW-KKAIGPTPGEYKDFLYEPTVQLFPNGTIFFKK 772
            ...||:......|:|.:..|...|.|:.||.| |:..|              |.|....|:..|.
Mouse   337 MTSEPQSLLVDLGSDAVFSCAWIGNPSLTIVWMKRGSG--------------VVLSNEKTLTLKS 387

  Fly   773 ISKESQGHFLCEA-KNNIGSGVSKVIFLKVNVPAHFQTKTKQISVAKGKQVHVQCNVQGDNPID- 835
            :.:|..|.::|.| ...:|:| .:.:.|.||.|....:...|.:: .|::..::|.::...|.| 
Mouse   388 VRQEDAGKYVCRAVVPRVGAG-EREVTLTVNGPPIISSTQTQHAL-HGEKGQIKCFIRSTPPPDR 450

  Fly   836 --FKWKIQATQQYLDESLDSRYTIRDQVLDDGMVSELGISHTYRQD-TGIYICQASNAFGQDEMS 897
              :.||    :..|:.....|||:.....::|::|.|.||:..|.| ..||.|.|.|:||.|...
Mouse   451 IAWSWK----ENVLESGTSGRYTVETVNTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEI 511

  Fly   898 IQLIVQ----------EVPEQPKNLRINSQQ------------------SRSLQLTWSQPFAGNS 934
            |:|..|          |....|..:.|....                  :||.:.|..:|.....
Mouse   512 IRLKEQGSEMKSGAGLEAESVPMAVIIGVAVGAGVAFLVLMATIVAFCCARSQRSTGGRPGISGR 576

  Fly   935 PIEE-----------------------YHIYYKQISDIWQNAEHLTIAGAQTVIN---IQQLRPA 973
            ..|:                       ..|.:|:.|...:..:|.||  .|.:::   .||....
Mouse   577 GTEKKARLRLPRRANLKGVVSAKNDIRVEIVHKEPSSGREAEDHTTI--KQLMMDRGEFQQDSVL 639

  Fly   974 KAYHIRMSAENKLGASEFSEV-------VQVTTLEEVPSGPPLAVRAEPKSSTEIFVTWDAPERD 1031
            |...: :..|.|    ||..:       ..|.|.:|..|.|.:::.:                  
Mouse   640 KQLEV-LKEEEK----EFQNLKDPTNGYYSVNTFKEHHSTPTISLSS------------------ 681

  Fly  1032 HWNGILLGYYVGYQMSLTPEDKEVNPTQGFSFKTVEVRSHFGGETVLANLNKFTQYHVIVQAYTS 1096
                        .|..|.|..|:..|| |.||  ..:.|...|:   ..|..:.|..|:      
Mouse   682 ------------CQPDLRPTGKQRVPT-GMSF--TNIYSTLSGQ---GRLYDYGQRFVL------ 722

  Fly  1097 QGSGPPSKEIAVQTMEDVPSSPPES---PQCDVLGSTSIYITWSPPDIDGQNGKIKGYKVF 1154
             |.|..|.|:..:..:....|...|   .|||...|:|              ||..||..|
Mouse   723 -GMGSSSIELCEREFQRGSLSDSSSFLDTQCDSSVSSS--------------GKQDGYVQF 768

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam4NP_001261571.1 Ig 31..124 CDD:472250
Ig strand B 50..54 CDD:409353
Ig strand C 63..66 CDD:409353
Ig strand E 82..86 CDD:409353
Ig strand F 102..107 CDD:409353
Ig strand G 115..119 CDD:409353
Ig 235..326 CDD:472250
Ig strand B 253..257 CDD:409353
Ig strand C 266..270 CDD:409353
Ig strand E 292..296 CDD:409353
Ig strand F 306..311 CDD:409353
Ig strand G 319..322 CDD:409353
IgC2_3_Dscam 329..417 CDD:409549
Ig strand A 330..335 CDD:409549
Ig strand A' 338..342 CDD:409549
Ig strand B 345..355 CDD:409549
Ig strand C 360..366 CDD:409549
Ig strand C' 367..370 CDD:409549
Ig strand E 383..389 CDD:409549
Ig strand F 396..404 CDD:409549
Ig strand G 407..417 CDD:409549
IgI_4_Dscam 422..516 CDD:409548 30/106 (28%)
Ig strand A' 430..434 CDD:409548 1/3 (33%)
Ig strand B 437..446 CDD:409548 3/8 (38%)
Ig strand C 451..457 CDD:409548 1/5 (20%)
Ig strand C' 459..462 CDD:409548 2/4 (50%)
Ig strand D 467..475 CDD:409548 4/14 (29%)
Ig strand E 479..488 CDD:409548 2/8 (25%)
Ig strand F 495..503 CDD:409548 3/8 (38%)
Ig strand G 506..516 CDD:409548 2/9 (22%)
IgI_5_Dscam 520..607 CDD:409550 26/108 (24%)
Ig strand A 520..522 CDD:409550 1/1 (100%)
Ig strand A' 527..531 CDD:409550 1/3 (33%)
Ig strand B 534..541 CDD:409550 1/6 (17%)
Ig strand C 548..554 CDD:409550 2/5 (40%)
Ig strand C' 555..557 CDD:409550 0/1 (0%)
Ig strand D 564..568 CDD:409550 0/3 (0%)
Ig strand E 571..577 CDD:409550 1/5 (20%)
Ig strand F 585..593 CDD:409550 2/7 (29%)
Ig strand G 597..607 CDD:409550 4/9 (44%)
Ig 610..703 CDD:472250 14/92 (15%)
Ig strand B 629..633 CDD:409353 0/3 (0%)
Ig strand C 643..647 CDD:409353 1/3 (33%)
Ig strand E 669..673 CDD:409353 0/3 (0%)
Ig strand F 683..688 CDD:409353 1/4 (25%)
Ig strand G 696..699 CDD:409353 0/2 (0%)
IgI_7_Dscam 706..801 CDD:409546 24/96 (25%)
Ig strand A 706..710 CDD:409546 1/3 (33%)
Ig strand A' 715..719 CDD:409546 0/3 (0%)
Ig strand B 722..731 CDD:409546 2/8 (25%)
Ig strand C 737..743 CDD:409546 4/6 (67%)
Ig strand C' 749..752 CDD:409546 0/2 (0%)
Ig strand D 760..763 CDD:409546 1/2 (50%)
Ig strand E 766..772 CDD:409546 1/5 (20%)
Ig strand F 779..787 CDD:409546 3/8 (38%)
Ig strand G 792..801 CDD:409546 2/8 (25%)
Ig 804..889 CDD:472250 23/88 (26%)
Ig strand B 822..826 CDD:409353 0/3 (0%)
Ig strand C 835..839 CDD:409353 1/6 (17%)
FN3 <850..1254 CDD:442628 78/370 (21%)
Ig strand F 882..887 CDD:409353 3/4 (75%)
FN3 906..999 CDD:238020 22/143 (15%)
fn3 1117..1203 CDD:394996 12/41 (29%)
FN3 1185..>1580 CDD:442628
FN3 1405..1494 CDD:238020
Kirrel3NP_001420714.1 IG_like 54..143 CDD:214653 27/99 (27%)
Ig strand B 65..69 CDD:409390 2/3 (67%)
Ig strand C 73..81 CDD:409390 3/11 (27%)
Ig strand E 110..114 CDD:409390 1/3 (33%)
Ig strand F 124..129 CDD:409390 2/4 (50%)
Ig strand G 135..139 CDD:409390 1/5 (20%)
IgI_2_KIRREL3-like 149..246 CDD:409416 26/109 (24%)
Ig strand A 150..153 CDD:409416 1/2 (50%)
Ig strand A' 156..160 CDD:409416 2/3 (67%)
Ig strand B 167..174 CDD:409416 1/6 (17%)
Ig strand C 179..184 CDD:409416 1/4 (25%)
Ig strand C' 187..189 CDD:409416 1/1 (100%)
Ig strand D 192..199 CDD:409416 1/6 (17%)
Ig strand E 206..214 CDD:409416 0/7 (0%)
Ig strand F 223..231 CDD:409416 2/7 (29%)
Ig strand G 237..243 CDD:409416 3/8 (38%)
Ig <267..334 CDD:472250 12/76 (16%)
Ig strand B 267..271 CDD:409437 0/3 (0%)
Ig strand C 280..285 CDD:409437 1/4 (25%)
Ig strand E 304..308 CDD:409437 1/13 (8%)
Ig strand G 326..329 CDD:409437 0/2 (0%)
Ig 335..416 CDD:472250 24/95 (25%)
Ig strand B 352..356 CDD:409549 0/3 (0%)
Ig strand C 365..369 CDD:409549 2/3 (67%)
Ig strand E 381..385 CDD:409549 1/3 (33%)
IgI_5_KIRREL3 418..515 CDD:409479 28/101 (28%)
Ig strand A 419..423 CDD:409479 1/3 (33%)
Ig strand A' 425..428 CDD:409479 0/2 (0%)
Ig strand B 436..443 CDD:409479 1/6 (17%)
Ig strand C 450..455 CDD:409479 0/4 (0%)
Ig strand C' 457..460 CDD:409479 0/2 (0%)
Ig strand D 468..475 CDD:409479 2/6 (33%)
Ig strand E 478..485 CDD:409479 3/6 (50%)
Ig strand F 496..503 CDD:409479 4/6 (67%)
Ig strand G 506..513 CDD:409479 2/6 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.