DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam4 and ROBO3

DIOPT Version :10

Sequence 1:NP_001261571.1 Gene:Dscam4 / 2769008 FlyBaseID:FBgn0263219 Length:1935 Species:Drosophila melanogaster
Sequence 2:NP_071765.2 Gene:ROBO3 / 64221 HGNCID:13433 Length:1386 Species:Homo sapiens


Alignment Length:1629 Identity:337/1629 - (20%)
Similarity:549/1629 - (33%) Gaps:514/1629 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   409 IQSTAELQLG----------------------------DASPELLYWFSEQTLQPGPTVSLKCVA 445
            |.:::||.||                            ||.|.::....:..:..|...:|.|.|
Human    23 ISNSSELLLGFNSSLAALNHTLLPPGDPSLNGSRVGPEDAMPRIVEQPPDLLVSRGEPATLPCRA 87

  Fly   446 TGNPLPQFTWSLDGFPIPDSSRFLVGQYVTIHDDVISH-------------VNISNVKEEDGGEY 497
            .|.|.|...|..:|           .:..|:.:|..:|             :........|.|.|
Human    88 EGRPRPNIEWYKNG-----------ARVATVREDPRAHRLLLPSGALFFPRIVHGRRARPDEGVY 141

  Fly   498 TCTAQNAIG-KVSHSAKVNIYGL-PYIREMP-KITGISGSDLIVKC-PVAGYPIDKIHWERDGQT 558
            ||.|:|.:| ..|.:|.:.:..| ...|:.| .:....|...:::| |..|:|...:.|.:||..
Human   142 TCVARNYLGAAASRNASLEVAVLRDDFRQSPGNVVVAVGEPAVLECVPPRGHPEPSVSWRKDGAR 206

  Fly   559 LPINRRQRAYNNGTLIIEQLQRLEDAGTYTCMAQNKQKQTSRRNVEIQVLVPPKIMPIQAMTNML 623
            |.....:.....|.|::....: .|||.|.|:|.|...:......|:.||..|..:. :.:..::
Human   207 LKEEEGRITIRGGKLMMSHTLK-SDAGMYVCVASNMAGERESAAAEVMVLERPSFLR-RPVNQVV 269

  Fly   624 REGMRAAISCQILEGDLPVSFRWERNGKPLIGTGNEVFRRLDEYSASLVIEHISSDHSGNYTCIA 688
            .........|:: :||.|...||.:....| .||....|.    ..||.|.|:|::..|.|||:|
Human   270 LADAPVTFLCEV-KGDPPPRLRWRKEDGEL-PTGRYEIRS----DHSLWIGHVSAEDEGTYTCVA 328

  Fly   689 SNVAGTERFTVPLTVNVPPKWILEPKDSSAQAGADVLLHCQSSGYPTPTITWKKAIGPTPGEYKD 753
            .|..|....:..|:|:|||:.:.:|:|..|..|..|...|::.|.|.|.|.|:|       |...
Human   329 ENSVGRAEASGSLSVHVPPQLVTQPQDQMAAPGESVAFQCETKGNPPPAIFWQK-------EGSQ 386

  Fly   754 FLYEPTVQL--------FPNGTIFFKKISKESQGHFLCEAKNNIGSGVSKVIFLKVN-------V 803
            .|..|:..|        .|.|.:....:.:...|:::|:|.:..||.::|.: |::.       .
Human   387 VLLFPSQSLQPTGRFSVSPRGQLNITAVQRGDAGYYVCQAVSVAGSILAKAL-LEIKGASLDGLP 450

  Fly   804 PAHFQTKTKQISVAKGKQVHVQCNVQGDNPIDFKWKIQATQQYLDESLDSRYTIRDQVLDDGMVS 868
            |...|....| ::..|..|.:.|.|.|:.....:||           .|.::...|.:....|.:
Human   451 PVILQGPANQ-TLVLGSSVWLPCRVTGNPQPSVRWK-----------KDGQWLQGDDLQFKTMAN 503

  Fly   869 -ELGISHTYRQDTGIYICQASNAFGQDEMSIQLIVQE-----------------VPEQPKNLRIN 915
             .|.|::....|.|.|.|.|.::.|:...|..|.::|                 .|.||....|.
Human   504 GTLYIANVQEMDMGFYSCVAKSSTGEATWSGWLKMREDWGVSPDPPTEPSSPPGAPSQPVVTEIT 568

  Fly   916 SQQSRSLQLTWS-----------------QPFAGNSPIEEYHIYYKQISDIWQNAEHLTIAGAQT 963
               ..|:.|||.                 .|.|||:        ::.::|..|...| |::|   
Human   569 ---KNSITLTWKPNPQTGAAVTSYVIEAFSPAAGNT--------WRTVADGVQLETH-TVSG--- 618

  Fly   964 VINIQQLRPAKAYHIRMSAENKLGASEFSEVVQ-VTTLEEVPSGP------------PLAVRAE- 1014
                  |:|...|...:.|....|.||.|.|.: |.|.:..||.|            .:|||.: 
Human   619 ------LQPNTIYLFLVRAVGAWGLSEPSPVSEPVRTQDSSPSRPVEDPWRGQQGLAEVAVRLQE 677

  Fly  1015 -----PKSSTEIFVTW--DAPERDHWNGILLGYYVGYQMSLTPEDKEVNPTQGFSFKTVEVRSHF 1072
                 |::   :.|:|  |.|.:     ::.|:.|.:::: .||        |.|:..::::|..
Human   678 PIVLGPRT---LQVSWTVDGPVQ-----LVQGFRVSWRVA-GPE--------GGSWTMLDLQSPS 725

  Fly  1073 GGETVLANLNKFTQYHVIVQAYTSQGSGPPSKEIAVQTMEDVPSSPPESPQCDV--LGSTSIYIT 1135
            ...|||..|...||..:.|||...:|.|..|..:.....|:.||.||:.....:  .|::||.::
Human   726 QQSTVLRGLPPGTQIQIKVQAQGQEGLGAESLSVTRSIPEEAPSGPPQGVAVALGGDGNSSITVS 790

  Fly  1136 WSPPDIDGQNGKIKGYKVFYISVDELYETDPEVVKSTNQYVTIENLRKYTN---YTVWVLAYTKV 1197
            |.||....|||.|..|:::.:..:..:..:    :|...:.....||....   |...|.|.|..
Human   791 WEPPLPSQQNGVITEYQIWCLGNESRFHLN----RSAAGWARSAMLRGLVPGLLYRTLVAAATSA 851

  Fly  1198 GDGMKTKPFYCRTHEDVPSAPQAIKAIPASSSKIIISWLPPDLPNGDITGYTFYMSMLE------ 1256
            |.|             |||||..:: :|:          ||||..|...|....:.:..      
Human   852 GVG-------------VPSAPVLVQ-LPS----------PPDLEPGLEVGAGLAVRLARVLREPA 892

  Fly  1257 --GGREEGTHKRLLGPFVEMHETVRTQE-----SATYQFWLTASTKMGEGEKTQVVTVPPNNKVP 1314
              .|........|||....::...:.::     :|::.:....|....|| .:...:.||....|
Human   893 FLAGSGAACGALLLGLCAALYWRRKQRKELSHYTASFAYTPAVSFPHSEG-LSGASSRPPMGLGP 956

  Fly  1315 ARIVSFSQRIVTPWKEHLELPCRKVGAPAP--------------------VTIWRQDGHNMETSA 1359
            |   .:|. :...|..    |.|...|..|                    ::::      :..:|
Human   957 A---PYSW-LADSWPH----PSRSPSAQEPRGSCCPSNPDPDDRYYNEAGISLY------LAQTA 1007

  Fly  1360 RKTIAK-NGTLYM------KECQASDAG--NYTCSVENTWGKDEIVYNIVVKVPPEAPNLTVINA 1415
            |.|.|. .|.:|.      :|.|....|  .:.......|.:         ..||          
Human  1008 RGTAAPGEGPVYSTIDPAGEELQTFHGGFPQHPSGDLGPWSQ---------YAPP---------- 1053

  Fly  1416 YTDSLLLEWMDNSHG---------GSPILGYVINYKRD-------------NGDWEELQVDSKTT 1458
                   ||.....|         |.|:....:|:...             .|..|||:..|:..
Human  1054 -------EWSQGDSGAKGGKVKLLGKPVQMPSLNWPEALPPPPPSCELSCLEGPEEELEGSSEPE 1111

  Fly  1459 SHLLTNLWCGTRYQLYITAYNKIGTGLPCDIVNSYTKGNPPVQPKHSQMITNNSTSVTCWLDSWG 1523
            .      ||                              ||: |:.|. :|..|:|         
Human  1112 E------WC------------------------------PPM-PERSH-LTEPSSS--------- 1129

  Fly  1524 DGGCGILYFMIESR--------VYGRSSWAVVSNH-----IPPTE--RIYTVSDLVP-GTKYQLK 1572
             |||    .:..||        .||:.|.|.::..     .|||:  .::.:...|| |....|.
Human  1130 -GGC----LVTPSRRETPSPTPSYGQQSTATLTPSPPDPPQPPTDMPHLHQMPRRVPLGPSSPLS 1189

  Fly  1573 VT-----------AHNNAGSTTAIYNFTTLSTQGVIYNNDHSTPVSHLSDLP------------F 1614
            |:           |...||...:                      .|||..|            :
Human  1190 VSQPMLGIREARPAGLGAGPAAS----------------------PHLSPSPAPSTASSAPGRTW 1232

  Fly  1615 YANFKLLLPICFSLLMLLALIGAALFLRKRKLASQARLASS--------------------SMSE 1659
            ..|.::..|          |.|.....||:..|...|..:|                    .:..
Human  1233 QGNGEMTPP----------LQGPRARFRKKPKALPYRRENSPGDLPPPPLPPPEEEASWALELRA 1287

  Fly  1660 SPSLANLQNKQNRDQQYLAVRCNPGTSAPRGSNSNDSGSFGKAEGNEYIEDICPYA--TFQLNKQ 1722
            :.|:::|:.:::.:::  ||:..| .:|.|..:.::             |...||:  :|....|
Human  1288 AGSMSSLERERSGERK--AVQAVP-LAAQRVLHPDE-------------EAWLPYSRPSFLSRGQ 1336

  Fly  1723 TYSESSYSGNVYSGPYHSVRGSFVYHDVKPESYHSKEPEYTKVRRKVGRLRDPHSESQESDNPGS 1787
            ..|..|.:|:..|....|.|||                      |..||.|.......:|..||.
Human  1337 GTSTCSTAGSNSSRGSSSSRGS----------------------RGPGRSRSRSQSRSQSQRPGQ 1379

  Fly  1788 TDSE 1791
            ...|
Human  1380 KRRE 1383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam4NP_001261571.1 Ig 31..124 CDD:472250
Ig strand B 50..54 CDD:409353
Ig strand C 63..66 CDD:409353
Ig strand E 82..86 CDD:409353
Ig strand F 102..107 CDD:409353
Ig strand G 115..119 CDD:409353
Ig 235..326 CDD:472250
Ig strand B 253..257 CDD:409353
Ig strand C 266..270 CDD:409353
Ig strand E 292..296 CDD:409353
Ig strand F 306..311 CDD:409353
Ig strand G 319..322 CDD:409353
IgC2_3_Dscam 329..417 CDD:409549 3/7 (43%)
Ig strand A 330..335 CDD:409549
Ig strand A' 338..342 CDD:409549
Ig strand B 345..355 CDD:409549
Ig strand C 360..366 CDD:409549
Ig strand C' 367..370 CDD:409549
Ig strand E 383..389 CDD:409549
Ig strand F 396..404 CDD:409549
Ig strand G 407..417 CDD:409549 3/7 (43%)
IgI_4_Dscam 422..516 CDD:409548 23/107 (21%)
Ig strand A' 430..434 CDD:409548 0/3 (0%)
Ig strand B 437..446 CDD:409548 2/8 (25%)
Ig strand C 451..457 CDD:409548 2/5 (40%)
Ig strand C' 459..462 CDD:409548 1/2 (50%)
Ig strand D 467..475 CDD:409548 0/7 (0%)
Ig strand E 479..488 CDD:409548 2/21 (10%)
Ig strand F 495..503 CDD:409548 5/7 (71%)
Ig strand G 506..516 CDD:409548 3/10 (30%)
IgI_5_Dscam 520..607 CDD:409550 21/88 (24%)
Ig strand A 520..522 CDD:409550 0/1 (0%)
Ig strand A' 527..531 CDD:409550 0/3 (0%)
Ig strand B 534..541 CDD:409550 1/7 (14%)
Ig strand C 548..554 CDD:409550 1/5 (20%)
Ig strand C' 555..557 CDD:409550 1/1 (100%)
Ig strand D 564..568 CDD:409550 0/3 (0%)
Ig strand E 571..577 CDD:409550 2/5 (40%)
Ig strand F 585..593 CDD:409550 4/7 (57%)
Ig strand G 597..607 CDD:409550 1/9 (11%)
Ig 610..703 CDD:472250 24/92 (26%)
Ig strand B 629..633 CDD:409353 0/3 (0%)
Ig strand C 643..647 CDD:409353 1/3 (33%)
Ig strand E 669..673 CDD:409353 2/3 (67%)
Ig strand F 683..688 CDD:409353 3/4 (75%)
Ig strand G 696..699 CDD:409353 0/2 (0%)
IgI_7_Dscam 706..801 CDD:409546 27/102 (26%)
Ig strand A 706..710 CDD:409546 2/3 (67%)
Ig strand A' 715..719 CDD:409546 1/3 (33%)
Ig strand B 722..731 CDD:409546 2/8 (25%)
Ig strand C 737..743 CDD:409546 2/5 (40%)
Ig strand C' 749..752 CDD:409546 1/2 (50%)
Ig strand D 760..763 CDD:409546 1/10 (10%)
Ig strand E 766..772 CDD:409546 1/5 (20%)
Ig strand F 779..787 CDD:409546 3/7 (43%)
Ig strand G 792..801 CDD:409546 2/8 (25%)
Ig 804..889 CDD:472250 20/85 (24%)
Ig strand B 822..826 CDD:409353 1/3 (33%)
Ig strand C 835..839 CDD:409353 0/3 (0%)
FN3 <850..1254 CDD:442628 109/464 (23%)
Ig strand F 882..887 CDD:409353 2/4 (50%)
FN3 906..999 CDD:238020 27/110 (25%)
fn3 1117..1203 CDD:394996 22/90 (24%)
FN3 1185..>1580 CDD:442628 86/488 (18%)
FN3 1405..1494 CDD:238020 14/110 (13%)
ROBO3NP_071765.2 Ig 64..162 CDD:472250 23/108 (21%)
Ig strand B 81..85 CDD:409353 1/3 (33%)
Ig strand C 94..98 CDD:409353 0/3 (0%)
Ig strand E 121..125 CDD:409353 0/3 (0%)
Ig strand F 140..145 CDD:409353 3/4 (75%)
Ig strand G 154..157 CDD:409353 1/2 (50%)
Ig 169..254 CDD:472250 21/85 (25%)
Ig strand B 183..187 CDD:409353 0/3 (0%)
Ig strand C 197..201 CDD:409353 0/3 (0%)
Ig strand E 219..223 CDD:409353 2/3 (67%)
Ig strand F 233..238 CDD:409353 2/4 (50%)
Ig strand G 247..250 CDD:409353 0/2 (0%)
Ig 261..343 CDD:472250 23/88 (26%)
Ig strand B 275..279 CDD:409353 0/3 (0%)
Ig strand C 288..292 CDD:409353 1/3 (33%)
Ig strand E 309..313 CDD:409353 2/3 (67%)
Ig strand F 323..328 CDD:409353 3/4 (75%)
Ig strand G 336..339 CDD:409353 0/2 (0%)
Ig 348..445 CDD:472250 25/104 (24%)
Ig strand B 364..368 CDD:409353 1/3 (33%)
Ig strand C 377..381 CDD:409353 1/3 (33%)
Ig strand E 407..411 CDD:409353 1/3 (33%)
Ig strand F 421..426 CDD:409353 1/4 (25%)
Ig strand G 434..437 CDD:409353 0/2 (0%)
Ig 452..536 CDD:472250 21/95 (22%)
Ig strand B 468..472 CDD:409353 1/3 (33%)
Ig strand C 481..485 CDD:409353 0/3 (0%)
Ig strand E 504..508 CDD:409353 1/3 (33%)
FN3 <518..>809 CDD:442628 81/328 (25%)
Ig strand F 518..523 CDD:409353 2/4 (50%)
Ig strand G 531..534 CDD:409353 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 541..563 2/21 (10%)
FN3 556..649 CDD:238020 27/113 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 639..662 8/22 (36%)
FN3 770..863 CDD:238020 27/109 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 965..989 5/27 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1028..1310 64/394 (16%)
PRK12323 <1126..1325 CDD:481241 43/260 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1327..1386 18/79 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.