DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam4 and kirrel3a

DIOPT Version :10

Sequence 1:NP_001261571.1 Gene:Dscam4 / 2769008 FlyBaseID:FBgn0263219 Length:1935 Species:Drosophila melanogaster
Sequence 2:XP_068080114.1 Gene:kirrel3a / 571887 ZFINID:ZDB-GENE-091117-44 Length:788 Species:Danio rerio


Alignment Length:908 Identity:182/908 - (20%)
Similarity:307/908 - (33%) Gaps:268/908 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   390 VQKEDPGMYQCFVSNEWEQIQSTAELQLGDASPELLYWFSEQ----TLQPGPTVSLKCVATGNPL 450
            :.|....:.|.....:|... .||.|:.|..     ..|.:|    .:..|..|:|.|...|.. 
Zfish     5 ISKRVSSLTQILTFPKWRTC-GTANLEPGGC-----VMFIQQPHDLVIVAGEPVTLPCTIIGYQ- 62

  Fly   451 PQFTW-----------SLDGFP----IPDSSRFLVGQYVTIHDDVISHVNISNVKEEDGGEYTCT 500
            ....|           .|.|:|    |.|.|:   |:|         |:.|...:..|.|.:.|.
Zfish    63 GMVLWVKDGLALGVNRDLSGYPRYDVIGDHSK---GEY---------HLLIERTELVDDGSFECQ 115

  Fly   501 AQNAIGKVSHSAKVNIY---GLPYIREMPKITGISGSDLIVKCPV-AGYPIDKIHWERDGQTLPI 561
            |....|: |..|::.:.   ..|.|...|.::..:|..|.:.|.. ...|...|.|.|:|:.:  
Zfish   116 AIQVAGR-SRPAQLTVLVPPDDPVIIGAPVVSLRAGDSLNLTCHANNAKPAASIIWIRNGEVI-- 177

  Fly   562 NRRQRAYNNGTLIIEQLQR-----------------LEDAGTYTCMAQNKQKQTSRRNVEIQVLV 609
                    ||....:.|.|                 :|.....||.|.||.....:   |..|.:
Zfish   178 --------NGAAYTKTLLRDGKRESTVSTLHISASNIESGQQITCRASNKAAPNGK---EATVTI 231

  Fly   610 PPKIMPIQAMTNMLREGMRAAISCQILEGDL-----------PVS-FRWERNGKPLIGTGNEVFR 662
            ..:..|   :.|:..|..      .:|||:|           ||: :||.:.|..:.....:.:.
Zfish   232 DIQHFP---LVNLSVEPQ------PVLEGNLVKFHCAAKANPPVTHYRWAKGGSMITDATGDTYE 287

  Fly   663 RLDEYSASLVIEHISSDHSGNYTCIASNVAGTERFTVPLTVNVPPKWILEPKDSSAQAGADVLLH 727
            .|.::  |...|.:|        |..:|..|:...:..:.|...|:...||:......|:|.:..
Zfish   288 VLVDH--SFFTEPVS--------CEVTNALGSTNISRNVDVYFGPRLAAEPQSLQVDRGSDAVFS 342

  Fly   728 CQSSGYPTPTITW-KKAIGPTPGEYKDFLYEPTVQLFPNGTIFFKKISKESQGHFLCEA-KNNIG 790
            |...|.|:.||.| |:..|              |.|....|:..|.:.:|..|.::|.| ...:|
Zfish   343 CAWIGNPSLTIVWMKRGHG--------------VVLSNENTLTLKAVRQEDAGKYVCRAVVPRVG 393

  Fly   791 SGVSKVIFLKVNVPAHF-QTKTKQISVAKGKQVHVQCNVQGDNPID---FKWKIQATQQYLDESL 851
            .| .|.:.|.||.|... .|:|:|  ...|::..::|.::...|.|   :.||    :..|:...
Zfish   394 VG-EKEVMLTVNGPPSISSTQTQQ--ALYGEKGQIKCFIRSTPPPDRIAWSWK----ETVLESGT 451

  Fly   852 DSRYTIRDQVLDDGMVSELGISHTYRQD-TGIYICQASNAFGQDEMSIQLIVQEVPEQPKNLRI- 914
            ..|||:.....::|::|.|.:.:....| ..||.|.|.|:||.|...|:|      ::..:||: 
Zfish   452 SGRYTVETVSTEEGVISTLTMRNIVPTDFQTIYNCTAWNSFGSDTEIIRL------KEQGSLRLA 510

  Fly   915 -------------------------NSQQSRSLQLTWSQ-PFAGNSPIEEYHIYYKQISDIWQNA 953
                                     ...|.:.:.|..|. |.:.:|       ..::||...::.
Zfish   511 VIIGVAVGAFLALIVLIGTLGAFCCARLQRKDMHLVMSSLPVSLSS-------RQREISGTVKSE 568

  Fly   954 EHLTIAGAQTVINIQQL--------RPAKAYHIRMSAENKLGASEFSEVVQVTTLEEVPSGPPLA 1010
            ....:..|:..|.::.:        .|.:..:::.....:....:.|.:.|:..|:|        
Zfish   569 NLKGVVSAKNDIRVEIVHKDHNAAREPEEHSNVKQMMMERADFQQESVLKQLEVLQE-------- 625

  Fly  1011 VRAEPKSSTEIFVTWDAPERDHWNGILLGYYVGYQMSLTPEDKEVNPTQGFSF-KTVEVRSHFGG 1074
                           :..|..|......|||     |:....::..||...:. :..|||:    
Zfish   626 ---------------EERELQHIKDPTNGYY-----SVNTFKEQPTPTISLTANQNAEVRN---- 666

  Fly  1075 ETVLANLNKFTQYHVI------VQAYTSQGSGPP---------------------SKEIAVQTME 1112
             ...|.|.|    |.:      ...|.:.|:||.                     .:|....::.
Zfish   667 -PATATLGK----HRVPTGMSYTNIYNTLGAGPNRLYDYSQRFVLGMGSSSIELCEREFQRGSLS 726

  Fly  1113 DVPSSPPESPQCDVLGSTSIYITWSPPDIDGQNGKIKGYKVFYISVDELYETDPEVVKSTNQY 1175
            |  ||..:..|||  .|.|.|        ..|:|        |:..|:..:..   |.|::.|
Zfish   727 D--SSSFQDTQCD--SSVSSY--------SKQDG--------YVQFDKASKAS---VSSSSHY 766

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam4NP_001261571.1 Ig 31..124 CDD:472250
Ig strand B 50..54 CDD:409353
Ig strand C 63..66 CDD:409353
Ig strand E 82..86 CDD:409353
Ig strand F 102..107 CDD:409353
Ig strand G 115..119 CDD:409353
Ig 235..326 CDD:472250
Ig strand B 253..257 CDD:409353
Ig strand C 266..270 CDD:409353
Ig strand E 292..296 CDD:409353
Ig strand F 306..311 CDD:409353
Ig strand G 319..322 CDD:409353
IgC2_3_Dscam 329..417 CDD:409549 6/26 (23%)
Ig strand A 330..335 CDD:409549
Ig strand A' 338..342 CDD:409549
Ig strand B 345..355 CDD:409549
Ig strand C 360..366 CDD:409549
Ig strand C' 367..370 CDD:409549
Ig strand E 383..389 CDD:409549
Ig strand F 396..404 CDD:409549 1/7 (14%)
Ig strand G 407..417 CDD:409549 3/9 (33%)
IgI_4_Dscam 422..516 CDD:409548 25/112 (22%)
Ig strand A' 430..434 CDD:409548 1/7 (14%)
Ig strand B 437..446 CDD:409548 3/8 (38%)
Ig strand C 451..457 CDD:409548 1/16 (6%)
Ig strand C' 459..462 CDD:409548 2/6 (33%)
Ig strand D 467..475 CDD:409548 2/7 (29%)
Ig strand E 479..488 CDD:409548 2/8 (25%)
Ig strand F 495..503 CDD:409548 3/7 (43%)
Ig strand G 506..516 CDD:409548 3/9 (33%)
IgI_5_Dscam 520..607 CDD:409550 22/104 (21%)
Ig strand A 520..522 CDD:409550 1/1 (100%)
Ig strand A' 527..531 CDD:409550 0/3 (0%)
Ig strand B 534..541 CDD:409550 1/6 (17%)
Ig strand C 548..554 CDD:409550 2/5 (40%)
Ig strand C' 555..557 CDD:409550 0/1 (0%)
Ig strand D 564..568 CDD:409550 0/3 (0%)
Ig strand E 571..577 CDD:409550 1/5 (20%)
Ig strand F 585..593 CDD:409550 3/7 (43%)
Ig strand G 597..607 CDD:409550 1/9 (11%)
Ig 610..703 CDD:472250 19/104 (18%)
Ig strand B 629..633 CDD:409353 0/3 (0%)
Ig strand C 643..647 CDD:409353 1/4 (25%)
Ig strand E 669..673 CDD:409353 1/3 (33%)
Ig strand F 683..688 CDD:409353 1/4 (25%)
Ig strand G 696..699 CDD:409353 0/2 (0%)
IgI_7_Dscam 706..801 CDD:409546 25/96 (26%)
Ig strand A 706..710 CDD:409546 1/3 (33%)
Ig strand A' 715..719 CDD:409546 0/3 (0%)
Ig strand B 722..731 CDD:409546 2/8 (25%)
Ig strand C 737..743 CDD:409546 4/6 (67%)
Ig strand C' 749..752 CDD:409546 0/2 (0%)
Ig strand D 760..763 CDD:409546 1/2 (50%)
Ig strand E 766..772 CDD:409546 1/5 (20%)
Ig strand F 779..787 CDD:409546 3/8 (38%)
Ig strand G 792..801 CDD:409546 3/8 (38%)
Ig 804..889 CDD:472250 22/89 (25%)
Ig strand B 822..826 CDD:409353 0/3 (0%)
Ig strand C 835..839 CDD:409353 1/6 (17%)
FN3 <850..1254 CDD:442628 69/390 (18%)
Ig strand F 882..887 CDD:409353 3/4 (75%)
FN3 906..999 CDD:238020 14/127 (11%)
fn3 1117..1203 CDD:394996 14/59 (24%)
FN3 1185..>1580 CDD:442628
FN3 1405..1494 CDD:238020
kirrel3aXP_068080114.1 Ig 39..130 CDD:472250 24/104 (23%)
Ig strand B 52..56 CDD:409353 2/3 (67%)
Ig strand C 64..68 CDD:409353 0/3 (0%)
Ig strand E 92..101 CDD:409353 4/20 (20%)
Ig strand F 111..116 CDD:409353 1/4 (25%)
Ig strand G 123..126 CDD:409353 1/2 (50%)
IgI_2_KIRREL3-like 136..233 CDD:409416 23/109 (21%)
Ig strand A 137..140 CDD:409416 1/2 (50%)
Ig strand A' 143..147 CDD:409416 1/3 (33%)
Ig strand B 154..161 CDD:409416 1/6 (17%)
Ig strand C 166..171 CDD:409416 1/4 (25%)
Ig strand C' 174..176 CDD:409416 1/1 (100%)
Ig strand D 179..186 CDD:409416 1/6 (17%)
Ig strand E 193..201 CDD:409416 0/7 (0%)
Ig strand F 210..218 CDD:409416 3/7 (43%)
Ig strand G 224..230 CDD:409416 1/8 (13%)
Ig_2 241..318 CDD:464026 17/92 (18%)
Ig 322..403 CDD:472250 25/95 (26%)
Ig strand B 339..343 CDD:409353 0/3 (0%)
Ig strand C 352..356 CDD:409353 2/3 (67%)
Ig strand E 368..372 CDD:409353 1/3 (33%)
IgI_5_KIRREL3 405..502 CDD:409479 28/108 (26%)
Ig strand A 406..410 CDD:409479 1/3 (33%)
Ig strand A' 412..415 CDD:409479 1/2 (50%)
Ig strand B 423..430 CDD:409479 1/6 (17%)
Ig strand C 437..442 CDD:409479 0/4 (0%)
Ig strand C' 444..447 CDD:409479 0/2 (0%)
Ig strand D 455..462 CDD:409479 2/6 (33%)
Ig strand E 465..472 CDD:409479 3/6 (50%)
Ig strand F 483..490 CDD:409479 4/6 (67%)
Ig strand G 493..500 CDD:409479 2/6 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.