DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam4 and aebp1b

DIOPT Version :9

Sequence 1:NP_001261571.1 Gene:Dscam4 / 2769008 FlyBaseID:FBgn0263219 Length:1935 Species:Drosophila melanogaster
Sequence 2:XP_696022.6 Gene:aebp1b / 567630 ZFINID:ZDB-GENE-030131-8546 Length:1247 Species:Danio rerio


Alignment Length:1209 Identity:198/1209 - (16%)
Similarity:344/1209 - (28%) Gaps:439/1209 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   799 LKVNVPAHFQTKTKQISVAKGKQVHVQCNVQGDNPIDFKWKIQATQQYLDESLDSRYTIRDQVLD 863
            |:|.:...:.|    |.|.:.||  :.|.|..|.. :..|.....::.|.:..:.:......|| 
Zfish    56 LQVKIIPPYAT----IEVGQHKQ--LLCKVSSDAK-NINWVSPNGEKVLTKHGNLKVHNHGSVL- 112

  Fly   864 DGMVSELGISHTYRQDTGIYICQASNAFGQDEMSIQLIV-------------------------- 902
                |.|.:.:....:.|||.|.|:|...:.:.:::|.:                          
Zfish   113 ----SSLTVLNANLNNAGIYKCVATNGDTESQATVKLDIILKRMRRDTDRKGREKRLKEPKPSKK 173

  Fly   903 ---QEVPEQPKNL-------------RINSQQSRSLQLTWSQPFAGNSPIEEYHIYYKQISDIWQ 951
               .:..::||:.             :.|.::|.::..|...| ....|:|....|..:....|.
Zfish   174 PKASKPTKKPKSEKKGKGEKGGKKKGKKNREESTTVATTTVAP-TTTVPMEYEEFYDPEPDQYWD 237

  Fly   952 N---AEHLTIAGAQTVINIQQLRPAKAYHIRMSAENKLGASEFSEVVQVTTLEEVPSGPPLAVRA 1013
            .   ||..|:|...|.       |.:        :.|....:..|..|..:.::.....      
Zfish   238 EDFPAETTTVARTTTT-------PTE--------KTKDFIPDMDEYSQPDSYDDYWKVD------ 281

  Fly  1014 EPKSSTEIFVTWDAPERDHWNGILLGYYVGYQMSLTPEDKEVNPTQG-FSFKTVEVRS------- 1070
            ||..:|.:.....|.:.|:|:...:........   |:.||::.|.. :.:.|.|..:       
Zfish   282 EPTPTTSVIAGRPADDDDYWDARSVEMVENLPF---PDGKEISSTDNDWQYTTTEEPTVPPFENS 343

  Fly  1071 -----HFGGETVLANLNKFTQYHVIVQAYTSQGSGPPSKEIAVQTMEDVPSSPP-----ESPQCD 1125
                 .:|.|      .|..:....::....:......|.:..:..|.....||     |...|.
Zfish   344 WYEEYEYGHE------KKLEEERERLRKEQEEKEREERKRLEEEERERRIYRPPPRVYREPKICP 402

  Fly  1126 VLGSTSIYITWSPPDIDGQNGKIKGYKVFYISVDELYETDPEVVKSTNQYVTIENLRKYTNYTVW 1190
            .||..|..|                            :.|..:..|..|:       :|.::...
Zfish   403 PLGMESHRI----------------------------DNDQLLTSSVFQH-------RYGSHRAR 432

  Fly  1191 VLAYTKVGDGMKTKPFYCRTHEDVPSAPQAIKAIPASSSKIIISWLPPDLPNGDITGYTFYMSML 1255
            :.......|.......:|...|:.                  :.|:..|...  :|.:|   .::
Zfish   433 LNIQASGDDDDMNGGAWCANPEEK------------------VHWIEVDART--LTEFT---GVI 474

  Fly  1256 EGGREEGTHKRLLGPFVEMHETVRTQESATYQF-------WLTASTKMGEGEKTQVVTVPPNNKV 1313
            ..||::    .|...:|..:....:.:|..:.|       ||.    .|..:|...|.......|
Zfish   475 TQGRDD----PLESDYVSTYYVAFSNDSREWTFLHDGYAEWLF----FGNSDKNTPVLSQFMEPV 531

  Fly  1314 PARIVSFSQRIVTPWKEHLELPCRKVGAPAPVTIWRQDGHNMETSARKTIAKNGTLYMK----EC 1374
            .||.:    ||         ||          ..|                 |||:.|:    .|
Zfish   532 VARYI----RI---------LP----------QSW-----------------NGTMCMRMEILGC 556

  Fly  1375 QASDAGNYTCSVENTWGKDEIVY---------NIVVKVPPEAPNLTVINAYTDSL------LLEW 1424
            ...|..:...|......:|.:.|         .::..:..|.||:|...:...|.      .:|.
Zfish   557 PVQDPLSQHQSENEVTRRDNLDYTHHNYLDMEKLMKSISDECPNITRFYSLGKSFKGLEIYAMEI 621

  Fly  1425 MDN---SHGGSPILGYVINYKRDNGDWEELQVDSKTTSHLLTNLWCGTRYQLYITAYNKIGTGLP 1486
            .||   ...|.|...|...|..:.....||.:                .:..|:           
Zfish   622 TDNPGVHETGEPEFRYTAGYHGNEALGRELLL----------------MFMQYL----------- 659

  Fly  1487 CDIVNSYTKGNPPVQ-----------PK-----HSQMITNNSTSVTCWLDSWGDGGCGILYFMIE 1535
            |   ..|..|||.|:           |.     |.:.....|...:..|..|.:.|..|.     
Zfish   660 C---KEYKDGNPRVRHLVDETRIHLVPSVNPDGHVKAFEKGSELGSWTLGHWTEDGHDIF----- 716

  Fly  1536 SRVYGRSSWAVVSNHIPPTERIYTVSD---LVPGTKYQLKVTAHNNAGSTTAIYNFTTLSTQGVI 1597
                         .:.|....||..|:   :||      |:|.:::......|     ||:.|.|
Zfish   717 -------------QNFPDLNNIYWDSEDKGMVP------KLTPNHHIPIPEGI-----LSSNGSI 757

  Fly  1598 YNNDHSTPVSHLSDLPFYANFKLLLPICFSLLMLLALIGAALFLRKRKLAS----QARLASSSMS 1658
            .....:. :|.:...||                   ::||.| ....||.:    ..||...|.:
Zfish   758 AMETLAL-ISWMESHPF-------------------VLGANL-QGGEKLVTYPFDMRRLTKESEA 801

  Fly  1659 ESPSLANLQNKQNRDQQYLAVRCNP---------GTSAPRGSNSNDSGSFGKAEGNEYIEDICPY 1714
            ....|.:..|::.|..:......||         ..|.|:.:::.|..|:|              
Zfish   802 MEKKLGSRANRRKRQYEEEEEEPNPYLHIGYHQESYSGPQENHAYDHESYG-------------- 852

  Fly  1715 ATFQLNKQTYSESSYSGNVYSGPYH-SVRGSFVYHDVKPESYHSKEPEYTKVRRKVGRLRDPHSE 1778
                     |.:.||..:..|..|| ..:|   ||| :.:.||::...|             |:|
Zfish   853 ---------YHQESYGYHHQSQGYHEETQG---YHD-ETQGYHNENQGY-------------HNE 891

  Fly  1779 SQESDN-------------------------------PGSTDSEVRKI-------------LTLH 1799
            :|...|                               .|..:.|:|.:             .:.|
Zfish   892 NQGYHNENQRYHHEGYSEGYNEGYQEGYPEGYRGGYGEGEQEEEIRMVEDQSLFRWLAISYASTH 956

  Fly  1800 IPITEYDTLGSESDNDVSARAL-NSAKYRAQRDTQDETS 1837
            ..:|:....|..||:......: |.||::....:.|:.|
Zfish   957 RTMTQSYQRGCHSDDPTGGMGIVNRAKWKPIPGSMDDFS 995

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam4NP_001261571.1 Ig 31..124 CDD:416386
Ig strand A 32..35 CDD:409353
Ig strand A' 41..45 CDD:409353
Ig strand B 48..57 CDD:409353
Ig strand D 75..78 CDD:409353
Ig strand E 83..88 CDD:409353
Ig strand F 101..109 CDD:409353
Ig strand G 112..124 CDD:409353
Ig 235..326 CDD:416386
Ig strand A 235..238 CDD:409353
Ig strand A' 244..248 CDD:409353
Ig strand B 251..258 CDD:409353
Ig strand C 266..271 CDD:409353
Ig strand C' 276..279 CDD:409353
Ig strand D 285..289 CDD:409353
Ig strand E 292..298 CDD:409353
Ig strand F 305..313 CDD:409353
Ig strand G 316..326 CDD:409353
IgC2_3_Dscam 329..417 CDD:409549
Ig strand B 347..351 CDD:409549
Ig strand C 360..364 CDD:409549
Ig strand E 383..387 CDD:409549
Ig strand F 397..402 CDD:409549
Ig strand G 410..413 CDD:409549
IgI_4_Dscam 422..516 CDD:409548
Ig strand B 439..443 CDD:409548
Ig strand C 452..456 CDD:409548
Ig strand E 482..486 CDD:409548
Ig strand F 496..501 CDD:409548
Ig strand G 509..512 CDD:409548
IgI_5_Dscam 520..607 CDD:409550
Ig strand B 536..540 CDD:409550
Ig strand C 549..553 CDD:409550
Ig strand E 571..575 CDD:409550
Ig strand F 586..591 CDD:409550
Ig strand G 600..603 CDD:409550
Ig 610..703 CDD:416386
Ig strand A 611..613 CDD:409353
Ig strand A' 620..624 CDD:409353
Ig strand B 627..636 CDD:409353
Ig strand C 641..648 CDD:409353
Ig strand C' 650..652 CDD:409353
Ig strand D 659..664 CDD:409353
Ig strand E 668..675 CDD:409353
Ig strand F 682..690 CDD:409353
Ig strand G 693..702 CDD:409353
IgI_7_Dscam 706..801 CDD:409546 1/1 (100%)
Ig strand B 724..728 CDD:409546
Ig strand C 737..741 CDD:409546
Ig strand E 766..770 CDD:409546
Ig strand F 780..785 CDD:409546
Ig strand G 794..797 CDD:409546
Ig 818..904 CDD:416386 18/114 (16%)
putative Ig strand B 820..827 CDD:409353 2/6 (33%)
putative Ig strand C 835..841 CDD:409353 1/5 (20%)
putative Ig strand C' 853..856 CDD:409353 0/2 (0%)
putative Ig strand D 862..866 CDD:409353 1/3 (33%)
putative Ig strand E 868..874 CDD:409353 2/5 (40%)
putative Ig strand F 881..889 CDD:409353 5/7 (71%)
putative Ig strand G 892..902 CDD:409353 1/9 (11%)
FN3 906..999 CDD:238020 19/108 (18%)
FN3 1006..1110 CDD:238020 16/116 (14%)
fn3 1117..1203 CDD:394996 13/90 (14%)
FN3 1215..1307 CDD:238020 15/98 (15%)
Ig <1334..1401 CDD:416386 12/79 (15%)
Ig strand C 1345..1349 CDD:409353 0/3 (0%)
Ig strand D 1363..1366 CDD:409353 0/2 (0%)
Ig strand E 1367..1372 CDD:409353 2/4 (50%)
Ig strand F 1380..1388 CDD:409353 1/7 (14%)
Ig strand G 1394..1401 CDD:409353 1/15 (7%)
FN3 1405..1494 CDD:238020 16/97 (16%)
FN3 1499..1580 CDD:238020 16/99 (16%)
aebp1bXP_696022.6 Ig 56..147 CDD:299845 23/102 (23%)
IG_like 62..145 CDD:214653 20/94 (21%)
FA58C 402..555 CDD:238014 38/258 (15%)
FA58C 403..556 CDD:214572 38/258 (15%)
Peptidase_M14_like 577..1036 CDD:299699 93/539 (17%)
Peptidase_M14NE-CP-C_like 1040..1115 CDD:200604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.