DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam4 and igsf9a

DIOPT Version :9

Sequence 1:NP_001261571.1 Gene:Dscam4 / 2769008 FlyBaseID:FBgn0263219 Length:1935 Species:Drosophila melanogaster
Sequence 2:XP_005155702.1 Gene:igsf9a / 557459 ZFINID:ZDB-GENE-060503-288 Length:1619 Species:Danio rerio


Alignment Length:1947 Identity:397/1947 - (20%)
Similarity:632/1947 - (32%) Gaps:691/1947 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 LCWVNNT-AGEETIQVSLTVTAPLTAHL-QPQVQTVDVDKDAQFQCIVSGHPVHDVNWLHDG--K 368
            ||..|:| |.||.::.....:|.|...| .||       ||:.....|       :.|:..|  .
Zfish    16 LCLFNDTSAAEEHVRAKKDSSAVLPCSLPAPQ-------KDSSASQYV-------IEWVRQGFDT 66

  Fly   369 PILR------------DNRVEILTDPPRLIIKKVQKEDPGMYQCFV------------SNEWEQI 409
            ||..            |.||. |.....|.:..:|.||.|.|:|.:            |..|.::
Zfish    67 PIFMQLGVHPRVHPDYDGRVS-LFGGTSLQMSGLQLEDEGWYECRILPLDQTTEEAGSSGSWTRL 130

  Fly   410 QSTAELQLGDASPELLYWFSEQTLQPGPTVSLKCVATGNPLPQFTWSLDGFPI-PDSSRFLVGQY 473
            ..||...|.:.||      .|..:..|.:::|||.|.|||.|..|||.||.|| |.....:|...
Zfish   131 SVTAPPVLTETSP------PEVEVFVGRSLTLKCAAQGNPRPTITWSKDGAPIKPQHKVKMVNGS 189

  Fly   474 VTIHDDVISHVNISNVKEEDGGEYTCTAQNAIGKVSHSAKVNIYGLPYIREMPKITGISGS-DLI 537
            |:.|          .|..|..|:|.|...|:.|..:|..::.|.|.|.|...|..|.::.| |..
Zfish   190 VSFH----------AVSREAAGQYQCYTSNSEGNATHVTRLKIIGPPVIIIPPSDTVLNMSQDAK 244

  Fly   538 VKCPVAGYPIDKIH-WERDGQTL----PINRRQRAYNNGTLIIEQLQRLEDAGTYTCMAQNKQKQ 597
            :||.....|.:..: |:|.|..:    .:..|.:...:|||:|.:|.. ||:|.||||..|....
Zfish   245 LKCQAEADPPNMTYVWQRQGVDIYHIDSLKSRIKVIVDGTLLISRLAP-EDSGNYTCMPTNGLPV 308

  Fly   598 TSRRNVEIQVLVPPKIMPIQAMTNMLREGMRAAISCQILEGDLPVS-FRWERNGKPLIGTGNEVF 661
            :...:..:.|..|.:::.:..:| .|..|||.||.|.: ..:.|:| ..|.::||||        
Zfish   309 SPSASAVLTVQHPAQVIQMPKLT-FLPTGMRGAIVCPV-RAEPPLSHIDWIKDGKPL-------- 363

  Fly   662 RRLDEY-------SASLVIEHISSDHSGNYTCIASNVAGTERFTVPLTVNV--PPKWILEPKDSS 717
             .|..|       ..|:||..::.|.:|.|.|...|..||...:.|.||.:  ||.:.:.|::..
Zfish   364 -DLGMYPGWTLASDGSIVIATVNDDAAGVYICTPYNSFGTTGQSEPTTVILQDPPSFKVSPRNEY 427

  Fly   718 AQ-AGADVLLHCQSSGYPTPTITWKKAIGPTPGEYKDFLYEPTVQLFP---NGTIFFKKISKESQ 778
            .| .|..:::.||..|.|.|.:.|:| ||..           |..||.   ||::....:||:.|
Zfish   428 RQDVGTMLVIPCQMVGNPAPKVNWRK-IGAA-----------TRSLFTLAGNGSLILHPLSKDHQ 480

  Fly   779 GHFLCEAKNNIGSGVSKVIFLKVNVPAHFQTKTKQISVAKGKQVHVQCNVQGDNPIDFKWKIQAT 843
            |.:.|.:.|.:.:...|.:.|.:....|   ....:||           :.|.|..:..|.    
Zfish   481 GEWECSSSNRVATVSIKTMVLVLGTSPH---AVSSVSV-----------IPGTNQANVSWV---- 527

  Fly   844 QQYLDESLDSRYTIRDQVLDDGMVSELGISHTYRQDTGIYICQASNAFGQDEMSIQLIVQEVPEQ 908
                 ...|..||                                                    
Zfish   528 -----AGFDGGYT---------------------------------------------------- 535

  Fly   909 PKNLRINSQQSRSLQLTWSQPFAGNSPIEEYHIYYKQIS-------DIWQNAEHLTIAGAQTVIN 966
                                        :.:.::|||:|       ..|.:...|:...:..|.|
Zfish   536 ----------------------------QTFTVWYKQVSAGRTEEKQEWLSFSDLSTENSLLVTN 572

  Fly   967 IQQLRPAKAYHIRMSAENKLGASEFSEVVQVTTLEEVPSGPPLAVRAEP-------KSSTEIFVT 1024
               |.||..|...:.|:||:|...|||::.||||:.:    |:..:.||       |||....:.
Zfish   573 ---LLPATEYQFSVMAQNKIGTGPFSEIITVTTLDAL----PVVAKLEPPTNLSVNKSSEGFLLL 630

  Fly  1025 WDAP----------------ERDHWNGILLGYYVGYQMSLTPEDKEVNPTQGFSFKTVEVRSHFG 1073
            |.||                |...|:.:               .::::|.:...|          
Zfish   631 WSAPHSKSPPIDSFVVQSRLEGGEWDNL---------------KEDISPAESKIF---------- 670

  Fly  1074 GETVLANLNKFTQYHVIVQAYTSQGSGPPSKEIAVQT--MEDVPSSP-----PESPQCDVLGSTS 1131
                |..|.|..:|.:.:.:........||..|:|.|  |...|:|.     |......|:|...
Zfish   671 ----LPGLCKDCKYELRLLSQHGDQLSMPSPSISVSTFGMNMRPASSRLLDFPNHIMAGVMGGVG 731

  Fly  1132 I-------------YITWS------------PPDIDGQNGKIKGYKVFYISVDELYE--TDPEVV 1169
            :             :|::.            ||.:| :|..:.      |..|.|.:  .....:
Zfish   732 LLCLVLVLTLAIACFISYKRSRRRRQNIKDLPPAMD-KNASVN------IPDDTLKQRLLPAHPL 789

  Fly  1170 KSTNQYVTIENLRKYTNYTVWVLAYTKVGDGMKTKPFYCRTHEDVPSA-PQAIKAIPASSSKIII 1233
            .:::......:|.|:::                 ..|:......:|.| |.:..::|  .|.:.:
Zfish   790 STSSSASNHSSLDKFSH-----------------SDFHDLRQHHLPQANPPSHHSLP--ESHLQL 835

  Fly  1234 SWLPPDL--------PNGDIT-----GYTFYMSMLEGGREEGTHKRLLGPFVEMHETVRTQESAT 1285
            |.|.|..        |:|...     |.:.:.|.::....:.:|:...|     ..:.|.|:|.:
Zfish   836 SSLAPVSSVEFIHRGPDGRFVVHPGEGDSNFSSQIKRNPNQNSHQASDG-----SRSFRIQKSQS 895

  Fly  1286 YQFWLTASTKMGEGEKTQV---VTVPP-NNKVPARIVSFSQRIVTPWKEHLELPCRKVGAPAPVT 1346
            .:.:      |.|..:...   |.:|| .:.:|:   |...|.|.   :||.|            
Zfish   896 LRSY------MDEQRRPPFVLSVDLPPFGSNIPS---SSRTRAVV---KHLSL------------ 936

  Fly  1347 IWRQDGHNMETSARKTI-AKNGTLYMKECQASDAGNYTCSVENTWGKDEIVYNIVVKVPPEAPNL 1410
                :||.|....::.: ..:.|....:|  ||:..|..| |:|.|:         |.|..    
Zfish   937 ----NGHYMPILEKEIMDVPDQTSLSSDC--SDSYLYAHS-ESTLGQ---------KSPKR---- 981

  Fly  1411 TVINAYTDSLLLEWMDNSHGGSPILGYVINYKRDNG----------DWEELQ-------VDSKTT 1458
                           |.:|..:..|...:.::|:.|          :.|||:       ||..::
Zfish   982 ---------------DTNHSTASTLVLQMEHEREQGNLSRCLTLAREREELERELRKYTVDLNSS 1031

  Fly  1459 SHLLT-----NLW----CGTRYQLYITAYNKI---GTG-----------------------LPC- 1487
            ||..|     |||    ..|....|.|....|   .||                       ||. 
Zfish  1032 SHEQTDDEYGNLWKTQEASTPQVKYQTMRQSILSENTGMFKRRAASCIPWEERHKISSANLLPLH 1096

  Fly  1488 -----DIVNSYTKGNPPVQPKHSQMI--------------------TNNSTSVTCWLDSWGDGGC 1527
                 ||.....:|...||....|..                    |...:|..|.:|.      
Zfish  1097 KSYEKDIKYRQNQGYNSVQRSRYQRSRSLDREEHRKSHTWDQRRSKTPVESSRYCVIDE------ 1155

  Fly  1528 GILY-------------FMIESR--------VY---GRSSWAVVSNHIPPTERIYTVSDL----V 1564
             ::|             .|..||        :|   |...|..|..   ....|:.|.|.    |
Zfish  1156 -LIYKLENPQTCEGPRARMTSSRSQHYFDPCIYPSPGDQQWRTVQR---SNREIHPVGDYSEMSV 1216

  Fly  1565 PGTKYQLKVTAHNNAGSTT-AIYNFTTLSTQGVIYNNDHSTPVSHLSDLPFYANFKLLLPICFSL 1628
            .|..::   :.|.|:.||. :.:::.||         |:..|  .||:|..   .:|:.|     
Zfish  1217 DGPDFE---SQHANSRSTVRSEHSYETL---------DYDRP--RLSELEM---DRLVKP----- 1259

  Fly  1629 LMLLALIGAALFLRKRKLASQARLASSSMSES---PSLANLQNKQNRDQQY-------------- 1676
                   |.....:.:||.:.:....|.|:.|   |...|....:.|||..              
Zfish  1260 -------GHVSSRKDKKLNNWSSKTESPMNVSERMPQRTNSIGSKIRDQHQSTHSLDSKLYKDQF 1317

  Fly  1677 --------------------LAVRCNPGTSAPRGSNSNDSGSFGKAEGNEYIEDICPYATFQLNK 1721
                                |..|.|...:.|:.|.:....||..:....::..           
Zfish  1318 LTPDAWIDSLTLPQDCTMSPLVSRPNSVANKPKSSPNLQDHSFVPSGSQSHVPQ----------- 1371

  Fly  1722 QTYSESSYSGNVYSGPYHSVR---------------GSFVYHDVKPESYH--------------- 1756
               ..:|.|.|.::...||.|               ||.:     |.:|:               
Zfish  1372 ---RRASKSPNGFTNDQHSQRNLMSERNAHTALPPGGSSL-----PRAYYPSLSTLPSERRNQSH 1428

  Fly  1757 --SKEPE-------------YTKVRRKVGRLRDPHSESQESDNPGSTDSEVRKILTLHIPITEYD 1806
              .:|.|             |.|.....|..|   |...:|...||.|:...:..:|..|:|...
Zfish  1429 QAGREEEDMDGQDMDVEINIYRKGSETEGSYR---SYGSQSSGRGSMDAPNSRQFSLSPPLTSSP 1490

  Fly  1807 TLGSESDNDVSARALNSAKYRAQRDTQDETSSSSETTPTSMTRKSKPPFAARKGGK----PGTSG 1867
            ....:||.|.:  ||...:...:||:.||   |.|..|..:  ..:|..:..|.|.    .|:..
Zfish  1491 ETTEDSDRDEA--ALLDPEQNGRRDSVDE---SYEWEPAYV--PMRPVVSMNKTGLQKEFKGSQR 1548

  Fly  1868 KRHVRSSSGYSSHNEETTFSISNYP--------PNYQDHINPPARFSD----ANDKTKTQTS 1917
            |:...:....||:.::....:  ||        |.::....||::...    ..|..|:.||
Zfish  1549 KQSSITKDDDSSNLDQKQQGL--YPAAGLKGSVPLFEVPCVPPSQCQQESLLTRDIQKSFTS 1608

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam4NP_001261571.1 Ig 31..124 CDD:416386
Ig strand A 32..35 CDD:409353
Ig strand A' 41..45 CDD:409353
Ig strand B 48..57 CDD:409353
Ig strand D 75..78 CDD:409353
Ig strand E 83..88 CDD:409353
Ig strand F 101..109 CDD:409353
Ig strand G 112..124 CDD:409353
Ig 235..326 CDD:416386 7/18 (39%)
Ig strand A 235..238 CDD:409353
Ig strand A' 244..248 CDD:409353
Ig strand B 251..258 CDD:409353
Ig strand C 266..271 CDD:409353
Ig strand C' 276..279 CDD:409353
Ig strand D 285..289 CDD:409353
Ig strand E 292..298 CDD:409353
Ig strand F 305..313 CDD:409353 2/4 (50%)
Ig strand G 316..326 CDD:409353 2/9 (22%)
IgC2_3_Dscam 329..417 CDD:409549 26/114 (23%)
Ig strand B 347..351 CDD:409549 0/3 (0%)
Ig strand C 360..364 CDD:409549 0/3 (0%)
Ig strand E 383..387 CDD:409549 1/3 (33%)
Ig strand F 397..402 CDD:409549 2/4 (50%)
Ig strand G 410..413 CDD:409549 0/2 (0%)
IgI_4_Dscam 422..516 CDD:409548 30/94 (32%)
Ig strand B 439..443 CDD:409548 1/3 (33%)
Ig strand C 452..456 CDD:409548 1/3 (33%)
Ig strand E 482..486 CDD:409548 0/3 (0%)
Ig strand F 496..501 CDD:409548 2/4 (50%)
Ig strand G 509..512 CDD:409548 1/2 (50%)
IgI_5_Dscam 520..607 CDD:409550 26/92 (28%)
Ig strand B 536..540 CDD:409550 0/3 (0%)
Ig strand C 549..553 CDD:409550 0/4 (0%)
Ig strand E 571..575 CDD:409550 3/3 (100%)
Ig strand F 586..591 CDD:409550 3/4 (75%)
Ig strand G 600..603 CDD:409550 0/2 (0%)
Ig 610..703 CDD:416386 29/100 (29%)
Ig strand A 611..613 CDD:409353 0/1 (0%)
Ig strand A' 620..624 CDD:409353 1/3 (33%)
Ig strand B 627..636 CDD:409353 5/8 (63%)
Ig strand C 641..648 CDD:409353 3/7 (43%)
Ig strand C' 650..652 CDD:409353 1/1 (100%)
Ig strand D 659..664 CDD:409353 0/4 (0%)
Ig strand E 668..675 CDD:409353 3/6 (50%)
Ig strand F 682..690 CDD:409353 3/7 (43%)
Ig strand G 693..702 CDD:409353 3/8 (38%)
IgI_7_Dscam 706..801 CDD:409546 27/98 (28%)
Ig strand B 724..728 CDD:409546 0/3 (0%)
Ig strand C 737..741 CDD:409546 0/3 (0%)
Ig strand E 766..770 CDD:409546 1/3 (33%)
Ig strand F 780..785 CDD:409546 1/4 (25%)
Ig strand G 794..797 CDD:409546 1/2 (50%)
Ig 818..904 CDD:416386 6/85 (7%)
putative Ig strand B 820..827 CDD:409353 0/6 (0%)
putative Ig strand C 835..841 CDD:409353 1/5 (20%)
putative Ig strand C' 853..856 CDD:409353 0/2 (0%)
putative Ig strand D 862..866 CDD:409353 0/3 (0%)
putative Ig strand E 868..874 CDD:409353 0/5 (0%)
putative Ig strand F 881..889 CDD:409353 0/7 (0%)
putative Ig strand G 892..902 CDD:409353 0/9 (0%)
FN3 906..999 CDD:238020 20/99 (20%)
FN3 1006..1110 CDD:238020 21/126 (17%)
fn3 1117..1203 CDD:394996 14/117 (12%)
FN3 1215..1307 CDD:238020 20/108 (19%)
Ig <1334..1401 CDD:416386 13/67 (19%)
Ig strand C 1345..1349 CDD:409353 0/3 (0%)
Ig strand D 1363..1366 CDD:409353 0/3 (0%)
Ig strand E 1367..1372 CDD:409353 1/4 (25%)
Ig strand F 1380..1388 CDD:409353 2/7 (29%)
Ig strand G 1394..1401 CDD:409353 0/6 (0%)
FN3 1405..1494 CDD:238020 26/146 (18%)
FN3 1499..1580 CDD:238020 22/128 (17%)
igsf9aXP_005155702.1 IG_like 27..110 CDD:214653 23/97 (24%)
Ig 35..111 CDD:299845 23/90 (26%)
I-set 140..221 CDD:254352 31/96 (32%)
IGc2 151..212 CDD:197706 26/70 (37%)
Ig 233..318 CDD:299845 23/85 (27%)
I-set 233..318 CDD:254352 23/85 (27%)
Ig <349..402 CDD:299845 17/61 (28%)
IG_like 423..502 CDD:214653 24/90 (27%)
Ig 435..498 CDD:143165 20/74 (27%)
FN3 507..602 CDD:238020 29/200 (15%)
fn3 614..696 CDD:278470 15/110 (14%)
PHA02666 1105..>1312 CDD:222914 45/245 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.