DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam4 and kirrel3l

DIOPT Version :10

Sequence 1:NP_001261571.1 Gene:Dscam4 / 2769008 FlyBaseID:FBgn0263219 Length:1935 Species:Drosophila melanogaster
Sequence 2:NP_001092814.2 Gene:kirrel3l / 557315 ZFINID:ZDB-GENE-070831-1 Length:755 Species:Danio rerio


Alignment Length:901 Identity:195/901 - (21%)
Similarity:300/901 - (33%) Gaps:279/901 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   427 WFS----EQTLQPGPTVSLKCVATG-NPLPQFTWSLDGFPIPDSSRFLVG--QYVTIHDDVISH- 483
            :||    :|.:..|.:|:|.||..| ..:.|  |:.||..: ...|.|.|  :|..:.|.:... 
Zfish    19 YFSQQPQDQVVVAGQSVTLPCVIVGYRGMVQ--WTKDGLAL-GGERDLPGWVRYSLMGDPLSGEH 80

  Fly   484 -VNISNVKEEDGGEYTCTAQNAIGKVSHSAKVNIYGLPYIREMPKITGISGSDLIVK-------- 539
             :.|.:.:..|...|.|.|..| |..||.||:.:...|             ||.||:        
Zfish    81 SLVIDSAELGDDAIYECQATQA-GLRSHRAKLTVLVPP-------------SDPIVEGGPVVRLK 131

  Fly   540 --------CPVAG-YPIDKIHWERDGQ----------TLPINRRQRAYNNGTLIIEQLQRLEDAG 585
                    |..:| .|..:|.|.|||:          .:...:|:.|.:...::.|.    .|:|
Zfish   132 AHTPHNLTCRASGAKPAAEITWYRDGEIMQNAIYSKSLMEDGKRETAVSMLPMVPED----SDSG 192

  Fly   586 -TYTCMAQNKQKQTSRR-NVEIQVLVPPKI-MPIQAMTNMLREGMRAAISCQILEGDLPVSFRWE 647
             ||||...|......|: :|.|.|..||.: :.:|..|.|  ||.:....|..........:||.
Zfish   193 RTYTCRVLNPAAPAGRQTSVTINVQHPPSVTLSVQPQTVM--EGAKVLFICSASANPEITGYRWS 255

  Fly   648 RNGKPLIGTGNEVFRRLDEYSASLVIEHISSDHS---GNYTCIASNVAGTERFTVPLTVNVPPKW 709
            :.|.|:.....:          ||   .:::|||   ...:|..||..|:...:..:.|...|:.
Zfish   256 KGGVPISEANGD----------SL---EVTADHSYFTDPVSCEVSNSVGSTNVSTLVDVQFGPRL 307

  Fly   710 ILEPKDSSAQAGADVLLHCQSSGYPTPTITWKKAIGPTPGEYKDFLYEPTVQLFPNGTIFFKKIS 774
            :.|||......|.|....|..:|.|..|:.|.|             ....|.|..:.|:..|.::
Zfish   308 LTEPKPQIVDIGMDAAFTCSWTGNPPLTLAWTK-------------QGSNVVLSNSNTLQLKAVT 359

  Fly   775 KESQGHFLCEA-KNNIGSGVSKVIFLKVNVPAHFQTKTKQ--ISVAKGKQVHVQCNVQGDNPIDF 836
            ::..|.:.|:| ...||. ..:.:.|.||.|.....:..|  |..:|||   ::|.|....|.| 
Zfish   360 QDDTGTYTCKAIVPRIGV-AERDVTLTVNGPPIITAEATQQAIKHSKGK---LECLVGSSPPPD- 419

  Fly   837 KWKIQAT--QQYLDESLDSRYTIRDQVLDDGMVSELGISHTYRQDTGI-YICQASNAFGQDEMSI 898
              ||..|  ...|......|::::....|.|::|.|.:|.|..||..: |.|.|.|.||.....:
Zfish   420 --KIVWTFGDMMLSSGSSGRFSVQTVNSDQGVLSSLILSETLAQDFQLRYNCTAWNRFGTGTALV 482

  Fly   899 QLIVQEVPEQPKNLRINSQQSRSLQLTWSQPFAGNSPIEEYHIYYKQISDIWQNAEHLTIAGAQ- 962
            .|..||                :|.|                               |.|.||. 
Zfish   483 TLEEQE----------------ALPL-------------------------------LIIIGASV 500

  Fly   963 -----------TVINIQQLRPAKAYHIRMSAENKLGASEFSEVVQVTTL-------------EEV 1003
                       |:::|         ..|.:|:.|.|.......::|..:             |:|
Zfish   501 GGGCVFIVCVITLVSI---------CCRHNAKGKKGTRLSKSDIRVQIVHSDHNAARGNDDEEDV 556

  Fly  1004 --PSGP-----PLAVRAEPKSSTEIFVTWDAPERDHWNGILLGYYVGYQMSLTPEDKEVNPTQGF 1061
              |..|     |...|.|.....|        |.|.....:.....||......||:.:..| ||
Zfish   557 KEPMAPNSSESPGTSRTEHSDLLE--------EEDDERSDIKDPTNGYYNVRAHEDRHITRT-GF 612

  Fly  1062 S---------FKTVEVRSH---FGGETVLANLNKFTQYHVIVQA----YTSQGSGPPSKEIAVQT 1110
            |         :...::.|.   :|..:....:..|:|.:....|    |..|....|.::     
Zfish   613 SEYANNARPVYTPTQLPSPSPLYGQHSTQPRIYDFSQRYATTPANRTTYEQQQPQQPQQQ----- 672

  Fly  1111 MEDVPSSPPESPQCDVLGSTSIYITWSPPDIDGQNGKIKGYKVFYISVDELYETDPEVVKSTNQY 1175
                |.:|...||                                           |.|.|.:.|
Zfish   673 ----PQTPTAYPQ-------------------------------------------ETVYSGSTY 690

  Fly  1176 VTIENLRKYTNYTVWVLAYTKVGDGMKTKPFYCRTHEDVPSAPQAIKAIPASSSKI 1231
            :.....|.:|:| |...:|.|| ||.:        |.|..|...:......:||::
Zfish   691 LPATYGRAFTSY-VKPASYEKV-DGYE--------HSDQASKVSSSSRFSYASSQV 736

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam4NP_001261571.1 Ig 31..124 CDD:472250
Ig strand B 50..54 CDD:409353
Ig strand C 63..66 CDD:409353
Ig strand E 82..86 CDD:409353
Ig strand F 102..107 CDD:409353
Ig strand G 115..119 CDD:409353
Ig 235..326 CDD:472250
Ig strand B 253..257 CDD:409353
Ig strand C 266..270 CDD:409353
Ig strand E 292..296 CDD:409353
Ig strand F 306..311 CDD:409353
Ig strand G 319..322 CDD:409353
IgC2_3_Dscam 329..417 CDD:409549
Ig strand A 330..335 CDD:409549
Ig strand A' 338..342 CDD:409549
Ig strand B 345..355 CDD:409549
Ig strand C 360..366 CDD:409549
Ig strand C' 367..370 CDD:409549
Ig strand E 383..389 CDD:409549
Ig strand F 396..404 CDD:409549
Ig strand G 407..417 CDD:409549
IgI_4_Dscam 422..516 CDD:409548 29/97 (30%)
Ig strand A' 430..434 CDD:409548 1/3 (33%)
Ig strand B 437..446 CDD:409548 4/8 (50%)
Ig strand C 451..457 CDD:409548 2/5 (40%)
Ig strand C' 459..462 CDD:409548 1/2 (50%)
Ig strand D 467..475 CDD:409548 4/9 (44%)
Ig strand E 479..488 CDD:409548 1/10 (10%)
Ig strand F 495..503 CDD:409548 3/7 (43%)
Ig strand G 506..516 CDD:409548 5/9 (56%)
IgI_5_Dscam 520..607 CDD:409550 26/115 (23%)
Ig strand A 520..522 CDD:409550 1/1 (100%)
Ig strand A' 527..531 CDD:409550 0/3 (0%)
Ig strand B 534..541 CDD:409550 4/22 (18%)
Ig strand C 548..554 CDD:409550 2/5 (40%)
Ig strand C' 555..557 CDD:409550 1/1 (100%)
Ig strand D 564..568 CDD:409550 1/3 (33%)
Ig strand E 571..577 CDD:409550 0/5 (0%)
Ig strand F 585..593 CDD:409550 5/8 (63%)
Ig strand G 597..607 CDD:409550 3/10 (30%)
Ig 610..703 CDD:472250 21/96 (22%)
Ig strand B 629..633 CDD:409353 0/3 (0%)
Ig strand C 643..647 CDD:409353 1/3 (33%)
Ig strand E 669..673 CDD:409353 2/3 (67%)
Ig strand F 683..688 CDD:409353 1/4 (25%)
Ig strand G 696..699 CDD:409353 0/2 (0%)
IgI_7_Dscam 706..801 CDD:409546 22/95 (23%)
Ig strand A 706..710 CDD:409546 1/3 (33%)
Ig strand A' 715..719 CDD:409546 0/3 (0%)
Ig strand B 722..731 CDD:409546 2/8 (25%)
Ig strand C 737..743 CDD:409546 2/5 (40%)
Ig strand C' 749..752 CDD:409546 0/2 (0%)
Ig strand D 760..763 CDD:409546 1/2 (50%)
Ig strand E 766..772 CDD:409546 1/5 (20%)
Ig strand F 779..787 CDD:409546 3/8 (38%)
Ig strand G 792..801 CDD:409546 1/8 (13%)
Ig 804..889 CDD:472250 26/89 (29%)
Ig strand B 822..826 CDD:409353 0/3 (0%)
Ig strand C 835..839 CDD:409353 1/3 (33%)
FN3 <850..1254 CDD:442628 79/431 (18%)
Ig strand F 882..887 CDD:409353 2/5 (40%)
FN3 906..999 CDD:238020 13/104 (13%)
fn3 1117..1203 CDD:394996 16/85 (19%)
FN3 1185..>1580 CDD:442628 13/47 (28%)
FN3 1405..1494 CDD:238020
kirrel3lNP_001092814.2 Ig 19..113 CDD:472250 29/97 (30%)
Ig strand B 35..39 CDD:409353 2/3 (67%)
Ig strand C 47..51 CDD:409353 1/5 (20%)
Ig strand E 80..84 CDD:409353 0/3 (0%)
Ig strand F 94..99 CDD:409353 2/4 (50%)
Ig strand G 106..109 CDD:409353 2/2 (100%)
IgI_2_KIRREL3-like 119..216 CDD:409416 24/100 (24%)
Ig strand A 120..123 CDD:409416 1/2 (50%)
Ig strand A' 126..130 CDD:409416 0/3 (0%)
Ig strand B 137..144 CDD:409416 1/6 (17%)
Ig strand C 149..154 CDD:409416 1/4 (25%)
Ig strand C' 157..159 CDD:409416 1/1 (100%)
Ig strand D 162..169 CDD:409416 0/6 (0%)
Ig strand E 176..184 CDD:409416 1/7 (14%)
Ig strand F 193..201 CDD:409416 4/7 (57%)
Ig strand G 207..213 CDD:409416 1/5 (20%)
Ig_3 219..288 CDD:464046 18/83 (22%)
Ig 305..386 CDD:472250 22/94 (23%)
Ig strand B 322..326 CDD:409353 0/3 (0%)
Ig strand C 335..339 CDD:409353 1/3 (33%)
Ig strand E 351..355 CDD:409353 1/3 (33%)
IgI_5_KIRREL3-like 388..485 CDD:319310 29/102 (28%)
Ig strand A 389..393 CDD:319310 1/3 (33%)
Ig strand A' 395..398 CDD:319310 0/2 (0%)
Ig strand B 406..413 CDD:319310 3/9 (33%)
Ig strand C 420..425 CDD:319310 2/4 (50%)
Ig strand C' 427..430 CDD:319310 0/2 (0%)
Ig strand D 438..445 CDD:319310 0/6 (0%)
Ig strand E 448..455 CDD:319310 3/6 (50%)
Ig strand F 466..473 CDD:319310 3/6 (50%)
Ig strand G 476..483 CDD:319310 1/6 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.