DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam4 and KIRREL1

DIOPT Version :9

Sequence 1:NP_001261571.1 Gene:Dscam4 / 2769008 FlyBaseID:FBgn0263219 Length:1935 Species:Drosophila melanogaster
Sequence 2:XP_005245362.1 Gene:KIRREL1 / 55243 HGNCID:15734 Length:773 Species:Homo sapiens


Alignment Length:525 Identity:133/525 - (25%)
Similarity:214/525 - (40%) Gaps:92/525 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   429 SEQTLQPGPTVSLKCVATGNPLPQFTWSLDGFPIPDSS------RFLV------GQYVTIHDDVI 481
            ::||:..|....|.||.. |......|:.||..:....      |:.|      |||        
Human    28 ADQTVVAGQRAVLPCVLL-NYSGIVQWTKDGLALGMGQGLKAWPRYRVVGSADAGQY-------- 83

  Fly   482 SHVNISNVKEEDGGEYTCTAQNAIGKVSHSAKVNIYGLPYIREMPKITGISGSDLIVKCPVAGYP 546
             ::.|::.:..|...|.|.|..|..: |..||:.:. :|     |:.|.|.|..:|:.  .||.|
Human    84 -NLEITDAELSDDASYECQATEAALR-SRRAKLTVL-IP-----PEDTRIDGGPVILL--QAGTP 138

  Fly   547 ID------------KIHWERDG----------QTLPINRRQRAYNNGTLIIEQLQRLEDAGTYTC 589
            .:            .|.|.|||          :.|...:|:...:.  |:|.... |:....:||
Human   139 HNLTCRAFNAKPAATIIWFRDGTQQEGAVASTELLKDGKRETTVSQ--LLINPTD-LDIGRVFTC 200

  Fly   590 MAQNKQ----KQTSRRNVEIQVLVPPKI-MPIQAMTNMLREGMRAAISCQILEGDLPVSFRWERN 649
            .:.|:.    |:||   :|:.|..||.: :.|:..|  ::||.|...:||.......:.:||.:.
Human   201 RSMNEAIPSGKETS---IELDVHHPPTVTLSIEPQT--VQEGERVVFTCQATANPEILGYRWAKG 260

  Fly   650 GKPLIGTGNEVFRRLDEYSASLVIEHISSDHSGNYTCIASNVAGTERFTVPLTVNVPPKWILEPK 714
            |. ||...:| .|.......|...|.:|        |...|..|:...:..:.|:..|:.:::||
Human   261 GF-LIEDAHE-SRYETNVDYSFFTEPVS--------CEVHNKVGSTNVSTLVNVHFAPRIVVDPK 315

  Fly   715 DSSAQAGADVLLHCQSSGYPTPTITWKKA---IGP-TPGEYKDFLYEPTVQLFPNGTIFFKKISK 775
            .::...|:||.|.|...|.|..|:||.|.   :|| .||...:......| |..:..:..|.:::
Human   316 PTTTDIGSDVTLTCVWVGNPPLTLTWTKKDSNMGPRPPGSPPEAALSAQV-LSNSNQLLLKSVTQ 379

  Fly   776 ESQGHFLCEA-KNNIGSGVSKVIFLKVNVPAHFQTKTKQISVAKGKQVHVQCNVQGDNPID---F 836
            ...|.:.|.| ...||. ..:.:.|.||.|....::..|.:| :|....|:|.:....|.|   :
Human   380 ADAGTYTCRAIVPRIGV-AEREVPLYVNGPPIISSEAVQYAV-RGDGGKVECFIGSTPPPDRIAW 442

  Fly   837 KWKIQATQQYLDESLDSRYTIRDQVLDDGMVSELGISHTYRQDTGI-YICQASNAFGQDEMSIQL 900
            .||    :.:|:.....|||:.......|::|.|.|::....|... |.|.|.|:||.....|||
Human   443 AWK----ENFLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPGTAIIQL 503

  Fly   901 IVQEV 905
            ..:||
Human   504 EEREV 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam4NP_001261571.1 Ig 31..124 CDD:416386
Ig strand A 32..35 CDD:409353
Ig strand A' 41..45 CDD:409353
Ig strand B 48..57 CDD:409353
Ig strand D 75..78 CDD:409353
Ig strand E 83..88 CDD:409353
Ig strand F 101..109 CDD:409353
Ig strand G 112..124 CDD:409353
Ig 235..326 CDD:416386
Ig strand A 235..238 CDD:409353
Ig strand A' 244..248 CDD:409353
Ig strand B 251..258 CDD:409353
Ig strand C 266..271 CDD:409353
Ig strand C' 276..279 CDD:409353
Ig strand D 285..289 CDD:409353
Ig strand E 292..298 CDD:409353
Ig strand F 305..313 CDD:409353
Ig strand G 316..326 CDD:409353
IgC2_3_Dscam 329..417 CDD:409549
Ig strand B 347..351 CDD:409549
Ig strand C 360..364 CDD:409549
Ig strand E 383..387 CDD:409549
Ig strand F 397..402 CDD:409549
Ig strand G 410..413 CDD:409549
IgI_4_Dscam 422..516 CDD:409548 24/98 (24%)
Ig strand B 439..443 CDD:409548 1/3 (33%)
Ig strand C 452..456 CDD:409548 0/3 (0%)
Ig strand E 482..486 CDD:409548 0/3 (0%)
Ig strand F 496..501 CDD:409548 2/4 (50%)
Ig strand G 509..512 CDD:409548 1/2 (50%)
IgI_5_Dscam 520..607 CDD:409550 26/112 (23%)
Ig strand B 536..540 CDD:409550 1/3 (33%)
Ig strand C 549..553 CDD:409550 1/3 (33%)
Ig strand E 571..575 CDD:409550 1/3 (33%)
Ig strand F 586..591 CDD:409550 2/4 (50%)
Ig strand G 600..603 CDD:409550 0/2 (0%)
Ig 610..703 CDD:416386 22/93 (24%)
Ig strand A 611..613 CDD:409353 1/1 (100%)
Ig strand A' 620..624 CDD:409353 1/3 (33%)
Ig strand B 627..636 CDD:409353 3/8 (38%)
Ig strand C 641..648 CDD:409353 2/6 (33%)
Ig strand C' 650..652 CDD:409353 1/1 (100%)
Ig strand D 659..664 CDD:409353 2/4 (50%)
Ig strand E 668..675 CDD:409353 1/6 (17%)
Ig strand F 682..690 CDD:409353 1/7 (14%)
Ig strand G 693..702 CDD:409353 1/8 (13%)
IgI_7_Dscam 706..801 CDD:409546 27/99 (27%)
Ig strand B 724..728 CDD:409546 2/3 (67%)
Ig strand C 737..741 CDD:409546 2/3 (67%)
Ig strand E 766..770 CDD:409546 0/3 (0%)
Ig strand F 780..785 CDD:409546 1/4 (25%)
Ig strand G 794..797 CDD:409546 0/2 (0%)
Ig 818..904 CDD:416386 25/89 (28%)
putative Ig strand B 820..827 CDD:409353 1/6 (17%)
putative Ig strand C 835..841 CDD:409353 3/8 (38%)
putative Ig strand C' 853..856 CDD:409353 1/2 (50%)
putative Ig strand D 862..866 CDD:409353 0/3 (0%)
putative Ig strand E 868..874 CDD:409353 3/5 (60%)
putative Ig strand F 881..889 CDD:409353 3/8 (38%)
putative Ig strand G 892..902 CDD:409353 4/9 (44%)
FN3 906..999 CDD:238020 133/525 (25%)
FN3 1006..1110 CDD:238020
fn3 1117..1203 CDD:394996
FN3 1215..1307 CDD:238020
Ig <1334..1401 CDD:416386
Ig strand C 1345..1349 CDD:409353
Ig strand D 1363..1366 CDD:409353
Ig strand E 1367..1372 CDD:409353
Ig strand F 1380..1388 CDD:409353
Ig strand G 1394..1401 CDD:409353
FN3 1405..1494 CDD:238020
FN3 1499..1580 CDD:238020
KIRREL1XP_005245362.1 I-set 22..116 CDD:254352 24/98 (24%)
Ig 25..116 CDD:299845 24/98 (24%)
Ig2_KIRREL3-like 138..219 CDD:143236 18/86 (21%)
I-set 223..304 CDD:254352 21/92 (23%)
Ig_2 227..305 CDD:290606 20/89 (22%)
Ig_2 311..405 CDD:290606 26/95 (27%)
IG_like 314..405 CDD:214653 26/92 (28%)
Ig5_KIRREL3 407..504 CDD:143306 27/101 (27%)
IG_like 416..504 CDD:214653 26/92 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10991
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.