DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Dscam4 and dpr12

DIOPT Version :9

Sequence 1:	NP_001261571.1	Gene:	Dscam4 / 2769008	FlyBaseID:	FBgn0263219	Length:	1935	Species:	Drosophila melanogaster
Sequence 2:	NP_652462.3	Gene:	dpr12 / 50320	FlyBaseID:	FBgn0085414	Length:	326	Species:	Drosophila melanogaster

Alignment Length:	268	Identity:	71/268 - (26%)
Similarity:	102/268 - (38%)	Gaps:	54/268 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly   279 PLQLSE-RITIVSAGLLKIT-------KARLEDSGKYLCWV-NNTAGEETIQVSL-TVTAPL--T 331
            ||.|.| ||.::....|.:.       |:.|.|:.....|: ....|:..:..:| :..:|:  .
  Fly    15 PLHLMELRILLLCLPTLLLATTLEPDQKSILTDNDWKKLWMRGGINGDSKLDNNLDSSDSPMFED 79

  Fly   332 AHLQPQVQTVDVDKDAQFQCIVSGHPVHDVNW-------------LHDGKPI-LRDNRVEILTDP 382
            :.|.....||.:...|...|.|||.....|||             |..|..: ..|.|..||..|
  Fly    80 SELMAHNTTVQLGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAILHTP 144

  Fly   383 P----RLIIKKVQKEDPGMYQCFVSNEWEQIQSTAELQLGDASPE-LLYWFSEQTLQPGPTVSLK 442
            .    .|.||.||:.|.|||:|.||.....|.....||:  ..|| .:....|..:..|.|::|.
  Fly   145 GSNMWTLQIKFVQRRDHGMYECQVSTPTGIISHFVNLQV--VVPEAFILGSGELHVDMGSTINLV 207

  Fly   443 CVATGNPL-PQFT-WSLDGFPIPDSSRFLVGQYVTIHDDVI----------SHVNISNVKEEDGG 495
            |:...:|. ||:. |.       .:.|.:  .||....|:.          |.:.|...:..|.|
  Fly   208 CIIEKSPTPPQYVYWQ-------KNDRLI--NYVDSRRDITIETTPGPRTQSRLIIREPQVTDSG 263

  Fly   496 EYTCTAQN 503
            .|||:|.|
  Fly   264 NYTCSASN 271

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Dscam4	NP_001261571.1	Ig	31..124	CDD:416386
		Ig strand A	32..35	CDD:409353
		Ig strand A'	41..45	CDD:409353
		Ig strand B	48..57	CDD:409353
		Ig strand D	75..78	CDD:409353
		Ig strand E	83..88	CDD:409353
		Ig strand F	101..109	CDD:409353
		Ig strand G	112..124	CDD:409353
		Ig	235..326	CDD:416386	13/56 (23%)
		Ig strand A	235..238	CDD:409353
		Ig strand A'	244..248	CDD:409353
		Ig strand B	251..258	CDD:409353
		Ig strand C	266..271	CDD:409353
		Ig strand C'	276..279	CDD:409353	71/268 (26%)
		Ig strand D	285..289	CDD:409353	2/3 (67%)
		Ig strand E	292..298	CDD:409353	1/12 (8%)
		Ig strand F	305..313	CDD:409353	1/8 (13%)
		Ig strand G	316..326	CDD:409353	2/10 (20%)
		IgC2_3_Dscam	329..417	CDD:409549	33/107 (31%)
		Ig strand B	347..351	CDD:409549	1/3 (33%)
		Ig strand C	360..364	CDD:409549	3/16 (19%)
		Ig strand E	383..387	CDD:409549	1/7 (14%)
		Ig strand F	397..402	CDD:409549	3/4 (75%)
		Ig strand G	410..413	CDD:409549	0/2 (0%)
		IgI_4_Dscam	422..516	CDD:409548	24/95 (25%)
		Ig strand B	439..443	CDD:409548	1/3 (33%)
		Ig strand C	452..456	CDD:409548	1/4 (25%)
		Ig strand E	482..486	CDD:409548	1/3 (33%)
		Ig strand F	496..501	CDD:409548	3/4 (75%)
		Ig strand G	509..512	CDD:409548
		IgI_5_Dscam	520..607	CDD:409550
		Ig strand B	536..540	CDD:409550
		Ig strand C	549..553	CDD:409550
		Ig strand E	571..575	CDD:409550
		Ig strand F	586..591	CDD:409550
		Ig strand G	600..603	CDD:409550
		Ig	610..703	CDD:416386
		Ig strand A	611..613	CDD:409353
		Ig strand A'	620..624	CDD:409353
		Ig strand B	627..636	CDD:409353
		Ig strand C	641..648	CDD:409353
		Ig strand C'	650..652	CDD:409353
		Ig strand D	659..664	CDD:409353
		Ig strand E	668..675	CDD:409353
		Ig strand F	682..690	CDD:409353
		Ig strand G	693..702	CDD:409353
		IgI_7_Dscam	706..801	CDD:409546
		Ig strand B	724..728	CDD:409546
		Ig strand C	737..741	CDD:409546
		Ig strand E	766..770	CDD:409546
		Ig strand F	780..785	CDD:409546
		Ig strand G	794..797	CDD:409546
		Ig	818..904	CDD:416386
		putative Ig strand B	820..827	CDD:409353
		putative Ig strand C	835..841	CDD:409353
		putative Ig strand C'	853..856	CDD:409353
		putative Ig strand D	862..866	CDD:409353
		putative Ig strand E	868..874	CDD:409353
		putative Ig strand F	881..889	CDD:409353
		putative Ig strand G	892..902	CDD:409353
		FN3	906..999	CDD:238020
		FN3	1006..1110	CDD:238020
		fn3	1117..1203	CDD:394996
		FN3	1215..1307	CDD:238020
Ig	<1334..1401	CDD:416386
Ig strand C	1345..1349	CDD:409353
Ig strand D	1363..1366	CDD:409353
Ig strand E	1367..1372	CDD:409353
Ig strand F	1380..1388	CDD:409353
Ig strand G	1394..1401	CDD:409353
FN3	1405..1494	CDD:238020
FN3	1499..1580	CDD:238020
dpr12	NP_652462.3	IG	86..183	CDD:214652	31/96 (32%)
		Ig_3	193..271	CDD:404760	21/86 (24%)
		Ig strand B	204..208	CDD:409353	1/3 (33%)
		Ig strand C	219..223	CDD:409353	0/3 (0%)
		Ig strand E	250..254	CDD:409353	1/3 (33%)
		Ig strand F	264..269	CDD:409353	3/4 (75%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3510
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.900