DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam4 and Nrcam

DIOPT Version :9

Sequence 1:NP_001261571.1 Gene:Dscam4 / 2769008 FlyBaseID:FBgn0263219 Length:1935 Species:Drosophila melanogaster
Sequence 2:XP_017449758.1 Gene:Nrcam / 497815 RGDID:3209 Length:1315 Species:Rattus norvegicus


Alignment Length:1897 Identity:354/1897 - (18%)
Similarity:582/1897 - (30%) Gaps:724/1897 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KAILILYVIRAETSQFVNGLD---------------LQGPIFLHEPPHRVEFSNNSGGLIECSGH 57
            :|.|.|::     .|.::.||               :|.|....:.|...........:|:|...
  Rat    16 RAPLFLFL-----CQMISALDVPLDHGEKAKLLDDLVQPPTITQQSPKDYIIDPRENIVIQCEAK 75

  Fly    58 GSPPPEVEW----TPIPPQQDMVFQLSNGSMMFYPFTAEKYRHEVHATVYRCKLRNLVGTVLSRE 118
            |.|||...|    |.....:|.:..:..||.........:.:.|.:..||:|..||..|..:|..
  Rat    76 GKPPPSFSWTRNGTHFDIDKDPLVTMKPGSGTLVINIMSEGKAETYEGVYQCTARNERGAAVSNN 140

  Fly   119 VHVRGVVNQKYAVQVHDEYVM-TGNTAVLKCQVPSYMSEFVLVTAWVQDTGMHLYPNTDIGGKYT 182
            :.||...:..:..:..:..:: :|.:.||.|:.|..:...::.  |: |......|.::   :.:
  Rat   141 IVVRPSRSPLWTKERLEPIILRSGQSLVLPCRPPIGLPPAIIF--WM-DNSFQRLPQSE---RVS 199

  Fly   183 VLSNGELYINNAGPNDAYKSYTCRTVNRLTGEVQ---------IS------TYPGRIIVTE---- 228
            ...||:||.:|..|.|..:.|.|......|..:|         ||      |....:..||    
  Rat   200 QGLNGDLYFSNVLPEDTREDYICYARFNHTQTIQQKQPISLKVISVDELNDTIAANLSDTEFYGA 264

  Fly   229 ------PKGMVQPRIN-VEKHSMRHVVLNGQTTLPCIAQGHPVPTYRWFKEENEQLLPLQLSERI 286
                  |...:.|..| ..|..:|..||    :|.|||:|.|.|...|.||:             
  Rat   265 KSSKERPPTFLTPEGNESHKEELRGNVL----SLECIAEGLPTPVIYWIKED------------- 312

  Fly   287 TIVSAGLLKITKARLEDSGKYLCWVNNTAGEETIQVSLTVTAPLTAHLQPQVQTVDVDKDAQFQC 351
                 |.|.:.:....:..|            |:|:                             
  Rat   313 -----GTLPVNRTFYRNFKK------------TLQI----------------------------- 331

  Fly   352 IVSGHPVHDVNWLHDGKPILRDNRVEILTDPPRLIIKKVQKEDPGMYQCFVSNEWEQIQSTAELQ 416
                  :|                              |.:.|.|.|||...|....:..|..:.
  Rat   332 ------IH------------------------------VSEADSGNYQCIAKNALGAVHHTISVT 360

  Fly   417 LGDASPELLYWF---SEQTLQPGPTVSLKCVATGNPLPQFTWSLDGFPI----PDSSRFLVGQYV 474
            : .|:|   ||.   ....|.||...:|.|.|.|||.|:.:|..:|.|:    .|.||.:.|..:
  Rat   361 V-KAAP---YWIVAPHNLVLSPGENGTLICRANGNPKPRISWLTNGVPVEIALDDPSRKIDGDTI 421

  Fly   475 TIHDDVISHVNISNVKEEDGGEYTCTAQNAIGKVSHSAKVNIYGLPYIREMPKITG--------I 531
            .          .|||:|.....|.|.|.|..|.:..:|.||:     :.|.|:|..        |
  Rat   422 M----------FSNVQESSSAVYQCNASNKYGYLLANAFVNV-----LAEPPRILTSANTLYQVI 471

  Fly   532 SGSDLIVKCPVAGYPIDKIHWERDGQTLPINRRQRAYNNGTLIIEQLQRLEDAGTYTCMAQNKQK 596
            :....::.|...|.|:..|.|.:.             ..|:.:.|.:..|.|.||.         
  Rat   472 ANRPALLDCAFFGSPMPTIEWFKG-------------TKGSALHEDIYVLHDNGTL--------- 514

  Fly   597 QTSRRNVEIQVLVPPKIMPIQAMTNMLREGMRAAISCQILEGDLPVSFRWERNGKPLIGTGNEVF 661
                                                      ::||:                  
  Rat   515 ------------------------------------------EIPVA------------------ 519

  Fly   662 RRLDEYSASLVIEHISSDHSGNYTCIASNVAGTERFTVPLTVNVPPKWILEPKDSSAQAGADVLL 726
                           ..|.:|.|||:|.|..|..:..|.|.:..|.::|.:|:.:..|.|:.|..
  Rat   520 ---------------QKDSTGTYTCVARNKLGMAKNEVHLEIKDPTRFIKQPEYAVVQRGSKVSF 569

  Fly   727 HCQSSGYPT--PTITWKKAIGPTPGEYKDFLYEPTVQLFPNGTIFFKKISKESQGHFLCEAKNNI 789
            .|:.....|  |||.|.|..|..|.                                        
  Rat   570 ECKVKHDHTLIPTILWLKDNGELPN---------------------------------------- 594

  Fly   790 GSGVSKVIFLKVNVPAHFQTKTKQISVAKGKQVHVQCNVQGDNPIDFKWKIQATQQYLDESLDSR 854
                                                                          |.|
  Rat   595 --------------------------------------------------------------DER 597

  Fly   855 YTI-RDQVLDDGMVSELGISHTYRQDTGIYICQASNAFGQDEMSIQLI------------VQEVP 906
            ::: :|.::         :|....:|.|.|.|.|:...  |.:|...:            :.:||
  Rat   598 FSVDKDHLV---------VSDVKDEDGGTYTCAANTTL--DSVSASAVLRVVAPTPTPAPIYDVP 651

  Fly   907 EQPKNLRINSQQSRSLQLTWSQPFAGNSPIEEYHIYYKQI---SDIWQN-AEHLTIAGAQTVINI 967
            ..|.:|.:.:|..:|:||||:.....||||.::.|.|:..   :.:|:: ||   ::|.||...:
  Rat   652 NPPFDLELTNQLDKSVQLTWTPGDDNNSPITKFIIEYEDAMHEAGLWRHQAE---VSGTQTTAQL 713

  Fly   968 QQLRPAKAYHIRMSAENKLGASEFSEV-VQVTTLEEVPSGPPLAVRAEPKSSTEIFVTWDAPERD 1031
             :|.|...|..|:.|||.:|.|..||. .|..|....|...|.||.........:.:||......
  Rat   714 -KLSPYVNYSFRVMAENSIGRSVPSEASEQYLTKAAEPDQNPTAVEGLGTEPDNLVITWKPLNGF 777

  Fly  1032 HWNGILLGYYVGYQMSLTPEDKEVNPTQGFSFKTVEVRSHFGGETVLANLNK--------FTQYH 1088
            ..||..|.|.|.::.    :|.:...|                ..|:||::|        |..|.
  Rat   778 QSNGPGLQYKVSWRQ----KDGDDEWT----------------SVVVANVSKYIVSGTPTFVPYL 822

  Fly  1089 VIVQAYTSQGSGPPSKEIAVQTMEDVPSSPPESPQCDVLGSTSIYITWSPPDIDGQNGKIKGYKV 1153
            :.|||....|..|....:...:.||:|...|.:.:..|:.||.....|.|.......|.::||::
  Rat   823 IKVQALNDVGFAPEPAAVMGHSGEDLPMVAPGNVRVSVVNSTLAEAHWDPVPPKSVRGHLQGYRI 887

  Fly  1154 FYISVDELYETDPEVV-------KSTNQYVTIENLRKYTNYTVWVLAYTKVGDGMKTKPFYCRTH 1211
            :|.......:.:...:       :.:..:..:..|:.|::|.:.|......|:|..:......|.
  Rat   888 YYWKAQSSSKRNRRHIEKKILTFQGSKTHGMLPGLQPYSHYVLNVRVVNGKGEGPASADRGFHTP 952

  Fly  1212 EDVPSAPQAIKAIPASSSKIIISWLPPDLPNGDITGYTFYMSMLEGGREEGTHKRLLGPFVEM-- 1274
            |.|||||.::|.:..:...:.:.|.||..|||.:|.|     :|:......||:  |||.|::  
  Rat   953 EGVPSAPSSLKIVNPTLDSLTLEWDPPSHPNGILTEY-----ILKYQPINSTHE--LGPLVDLKI 1010

  Fly  1275 --HETVRTQE----SATYQFWLTASTKMGEGEKTQVVTVPPNNKVPARIVSFSQRIVTPWKEHLE 1333
              ::|..|.:    |..|:|:..|.|.:|.|.:                  .::..:|...|.  
  Rat  1011 PANKTRWTLKNLNFSTRYKFYFYAQTSVGSGSQ------------------ITEEAITTVDEG-- 1055

  Fly  1334 LPCRKVGAPAPVTIWRQDGHNMETSARKTIAKNGTLYMKECQASDAGNYTCSVENTWGKDEIVYN 1398
               :|.|...|                                 |.|.         ||      
  Rat  1056 ---KKAGILPP---------------------------------DVGA---------GK------ 1069

  Fly  1399 IVVKVPPEAPNLTVINAYTDSLLLEWMDNSHGGSPILGYVINYKRDNGDWEELQVDSKTTSHLLT 1463
             |..|.|...|:|...|.|.:                         |..||              
  Rat  1070 -VRAVSPRIGNVTAAAAETYA-------------------------NISWE-------------- 1094

  Fly  1464 NLWCGTRYQLYITAYNKIGTGLPCDIVNSYTKGNPPVQPKHSQMITNNSTSVTCWLDSWGDGGCG 1528
                   |:                            .|:|                        
  Rat  1095 -------YE----------------------------GPEH------------------------ 1100

  Fly  1529 ILYFMIESRVYG-RSSW--AVVSNHIPPTERIYTVSDLVPGTKYQLKVTAHNNAGSTTAIYNFTT 1590
             :.|.:|..|.| :..|  .:|:.    :...:.:..|:|||.|:::|.|..::|..::...|.|
  Rat  1101 -VKFYVEYGVAGSKEEWRKEIVNG----SRSFFGLKGLMPGTAYKVRVGAEGDSGFVSSEDVFET 1160

  Fly  1591 ----------LSTQGVIYNNDHSTPVSHLSDLPFYANFKLLLPICFSLLMLLALIGAALFLRKRK 1645
                      ::|||                      :.:.|....:||:|:.||  ..|:|:.|
  Rat  1161 GPAMASRQVDIATQG----------------------WFIGLMCAVALLILILLI--VCFIRRNK 1201

  Fly  1646 LASQARLASSSMSESPSLANLQNKQNRDQQYLAVRCNPGTSAP--RGSNSNDSGSFGKAEGNEYI 1708
            ...............|.:..::.......:|.:...:.....|  :||.:....:..|.:.::.:
  Rat  1202 GGKYPVKEKEDAHADPEIQPMKEDDGTFGEYRSFESDAEDHKPLKKGSRTPSDRTVKKEDSDDSL 1266

  Fly  1709 EDICPYATFQLNKQTYSESSYSGNVYSGPYHSVRGSFVYHDVKPESYHSKEPEYTKVRRKVGRLR 1773
            .|.......|.|:    :.|:.|. |||              |.|    |||.            
  Rat  1267 VDYGEGVNGQFNE----DGSFIGQ-YSG--------------KKE----KEPA------------ 1296

  Fly  1774 DPHSESQESDNP 1785
             ..:||.|:.:|
  Rat  1297 -EGNESSEAPSP 1307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam4NP_001261571.1 Ig 31..124 CDD:416386 23/96 (24%)
Ig strand A 32..35 CDD:409353 1/2 (50%)
Ig strand A' 41..45 CDD:409353 0/3 (0%)
Ig strand B 48..57 CDD:409353 2/8 (25%)
Ig strand D 75..78 CDD:409353 0/2 (0%)
Ig strand E 83..88 CDD:409353 1/4 (25%)
Ig strand F 101..109 CDD:409353 3/7 (43%)
Ig strand G 112..124 CDD:409353 4/11 (36%)
Ig 235..326 CDD:416386 21/91 (23%)
Ig strand A 235..238 CDD:409353 1/2 (50%)
Ig strand A' 244..248 CDD:409353 1/3 (33%)
Ig strand B 251..258 CDD:409353 1/6 (17%)
Ig strand C 266..271 CDD:409353 1/4 (25%)
Ig strand C' 276..279 CDD:409353 0/2 (0%)
Ig strand D 285..289 CDD:409353 0/3 (0%)
Ig strand E 292..298 CDD:409353 2/5 (40%)
Ig strand F 305..313 CDD:409353 1/7 (14%)
Ig strand G 316..326 CDD:409353 2/9 (22%)
IgC2_3_Dscam 329..417 CDD:409549 9/87 (10%)
Ig strand B 347..351 CDD:409549 0/3 (0%)
Ig strand C 360..364 CDD:409549 0/3 (0%)
Ig strand E 383..387 CDD:409549 0/3 (0%)
Ig strand F 397..402 CDD:409549 3/4 (75%)
Ig strand G 410..413 CDD:409549 0/2 (0%)
IgI_4_Dscam 422..516 CDD:409548 31/100 (31%)
Ig strand B 439..443 CDD:409548 1/3 (33%)
Ig strand C 452..456 CDD:409548 0/3 (0%)
Ig strand E 482..486 CDD:409548 0/3 (0%)
Ig strand F 496..501 CDD:409548 2/4 (50%)
Ig strand G 509..512 CDD:409548 0/2 (0%)
IgI_5_Dscam 520..607 CDD:409550 15/94 (16%)
Ig strand B 536..540 CDD:409550 0/3 (0%)
Ig strand C 549..553 CDD:409550 1/3 (33%)
Ig strand E 571..575 CDD:409550 1/3 (33%)
Ig strand F 586..591 CDD:409550 1/4 (25%)
Ig strand G 600..603 CDD:409550 0/2 (0%)
Ig 610..703 CDD:416386 12/92 (13%)
Ig strand A 611..613 CDD:409353 0/1 (0%)
Ig strand A' 620..624 CDD:409353 0/3 (0%)
Ig strand B 627..636 CDD:409353 0/8 (0%)
Ig strand C 641..648 CDD:409353 2/6 (33%)
Ig strand C' 650..652 CDD:409353 0/1 (0%)
Ig strand D 659..664 CDD:409353 0/4 (0%)
Ig strand E 668..675 CDD:409353 0/6 (0%)
Ig strand F 682..690 CDD:409353 5/7 (71%)
Ig strand G 693..702 CDD:409353 2/8 (25%)
IgI_7_Dscam 706..801 CDD:409546 15/96 (16%)
Ig strand B 724..728 CDD:409546 1/3 (33%)
Ig strand C 737..741 CDD:409546 2/3 (67%)
Ig strand E 766..770 CDD:409546 0/3 (0%)
Ig strand F 780..785 CDD:409546 0/4 (0%)
Ig strand G 794..797 CDD:409546 0/2 (0%)
Ig 818..904 CDD:416386 11/98 (11%)
putative Ig strand B 820..827 CDD:409353 0/6 (0%)
putative Ig strand C 835..841 CDD:409353 0/5 (0%)
putative Ig strand C' 853..856 CDD:409353 1/2 (50%)
putative Ig strand D 862..866 CDD:409353 0/3 (0%)
putative Ig strand E 868..874 CDD:409353 0/5 (0%)
putative Ig strand F 881..889 CDD:409353 4/7 (57%)
putative Ig strand G 892..902 CDD:409353 2/21 (10%)
FN3 906..999 CDD:238020 33/97 (34%)
FN3 1006..1110 CDD:238020 23/111 (21%)
fn3 1117..1203 CDD:394996 16/92 (17%)
FN3 1215..1307 CDD:238020 29/99 (29%)
Ig <1334..1401 CDD:416386 7/66 (11%)
Ig strand C 1345..1349 CDD:409353 0/3 (0%)
Ig strand D 1363..1366 CDD:409353 0/2 (0%)
Ig strand E 1367..1372 CDD:409353 0/4 (0%)
Ig strand F 1380..1388 CDD:409353 1/7 (14%)
Ig strand G 1394..1401 CDD:409353 0/6 (0%)
FN3 1405..1494 CDD:238020 9/88 (10%)
FN3 1499..1580 CDD:238020 15/83 (18%)
NrcamXP_017449758.1 IgI_NrCAM 50..144 CDD:409458 21/93 (23%)
Ig strand B 68..72 CDD:409458 1/3 (33%)
Ig strand C 81..85 CDD:409458 0/3 (0%)
Ig strand E 106..110 CDD:409458 0/3 (0%)
Ig strand F 124..129 CDD:409458 3/4 (75%)
Ig strand G 138..141 CDD:409458 1/2 (50%)
Ig 153..242 CDD:416386 19/94 (20%)
Ig strand A 153..156 CDD:409353 0/2 (0%)
Ig strand A' 158..162 CDD:409353 0/3 (0%)
Ig strand B 165..173 CDD:409353 3/7 (43%)
Ig strand C 180..186 CDD:409353 1/8 (13%)
Ig strand C' 189..192 CDD:409353 0/2 (0%)
Ig strand D 198..202 CDD:409353 0/3 (0%)
Ig strand E 204..208 CDD:409353 2/3 (67%)
Ig strand F 219..227 CDD:409353 2/7 (29%)
Ig strand G 230..242 CDD:409353 1/11 (9%)
Ig 281..362 CDD:416386 28/180 (16%)
Ig strand B 292..296 CDD:409353 2/7 (29%)
Ig strand C 305..309 CDD:409353 0/3 (0%)
Ig strand E 327..331 CDD:409353 2/15 (13%)
Ig strand F 341..346 CDD:409353 3/4 (75%)
Ig strand G 354..357 CDD:409353 0/2 (0%)
Ig 366..454 CDD:416386 31/102 (30%)
Ig strand B 382..386 CDD:409353 1/3 (33%)
Ig strand C 395..399 CDD:409353 0/3 (0%)
Ig strand E 419..423 CDD:409353 0/13 (0%)
Ig strand F 433..438 CDD:409353 2/4 (50%)
Ig strand G 446..449 CDD:409353 0/2 (0%)
Ig 460..546 CDD:416386 25/182 (14%)
Ig strand A 460..463 CDD:409353 1/2 (50%)
Ig strand A' 467..470 CDD:409353 0/2 (0%)
Ig strand B 476..483 CDD:409353 1/6 (17%)
Ig strand C 489..494 CDD:409353 2/4 (50%)
Ig strand C' 496..498 CDD:409353 0/1 (0%)
Ig strand D 505..509 CDD:409353 0/3 (0%)
Ig strand E 512..517 CDD:409353 2/55 (4%)
Ig strand F 525..533 CDD:409353 5/7 (71%)
Ig strand G 536..546 CDD:409353 3/9 (33%)
Ig 553..637 CDD:416386 25/196 (13%)
Ig strand A 553..556 CDD:409353 1/2 (50%)
Ig strand A' 558..562 CDD:409353 0/3 (0%)
Ig strand B 565..574 CDD:409353 2/8 (25%)
Ig strand C 582..587 CDD:409353 3/4 (75%)
Ig strand C' 590..593 CDD:409353 1/2 (50%)
Ig strand D 597..602 CDD:409353 1/4 (25%)
Ig strand E 603..609 CDD:409353 1/14 (7%)
Ig strand F 616..624 CDD:409353 4/7 (57%)
Ig strand G 627..637 CDD:409353 2/9 (22%)
FN3 651..741 CDD:238020 32/93 (34%)
fn3 754..836 CDD:394996 22/101 (22%)
fn3 852..944 CDD:394996 16/91 (18%)
fn3 957..1041 CDD:394996 27/90 (30%)
fn3 1075..1143 CDD:394996 22/170 (13%)
Bravo_FIGEY 1198..1287 CDD:404722 13/93 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.