DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam4 and NCAM2

DIOPT Version :10

Sequence 1:NP_001261571.1 Gene:Dscam4 / 2769008 FlyBaseID:FBgn0263219 Length:1935 Species:Drosophila melanogaster
Sequence 2:XP_011527877.1 Gene:NCAM2 / 4685 HGNCID:7657 Length:874 Species:Homo sapiens


Alignment Length:746 Identity:186/746 - (24%)
Similarity:305/746 - (40%) Gaps:87/746 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   405 EWEQIQSTAELQLGDASPELLY---------WFSEQTLQPGPTVSLKCVATGNPLPQFTWSLDGF 460
            :|:..::   |.|.:..||..|         ..|:..|..|.:....|.|.|.|     .|:|.:
Human    23 DWKYNEA---LYLEEGQPETYYRTALLQVTISLSKVELSVGESKFFTCTAIGEP-----ESIDWY 79

  Fly   461 PIPDSSRFLVGQYVTIH-DDVISHVNISNVKEEDGGEYTCTAQNAIGKVSHSAKV-NIYGLPYIR 523
            . |...:.:..|.|.:. :.|.|.:.|.|...||.|.|.|.|.:|.|:...:..| .||.....|
Human    80 N-PQGEKIISTQRVVVQKEGVRSRLTIYNANIEDAGIYRCQATDAKGQTQEATVVLEIYQKLTFR 143

  Fly   524 EMPKITGIS------GSDLIVKCPVAGYPIDKIHW---ERDGQTLPINRRQRAYNNGTLIIEQLQ 579
            |:     :|      |.|..|.|.|:..|...:.|   ..:..|:..||.....||...|:.  .
Human   144 EV-----VSPQEFKQGEDAEVVCRVSSSPAPAVSWLYHNEEVTTISDNRFAMLANNNLQILN--I 201

  Fly   580 RLEDAGTYTCMAQNKQK-QTSRRNVEIQVLVPPKI-MPIQAMTNMLREGMRAAISCQILEGDLPV 642
            ...|.|.|.|..:.:.: :...|::.:.|.|||.| ||.::.......|.....||: ..|....
Human   202 NKSDEGIYRCEGRVEARGEIDFRDIIVIVNVPPAISMPQKSFNATAERGEEMTFSCR-ASGSPEP 265

  Fly   643 SFRWERNGKPLIGTGNEVFRRLDEYSASLVIEHISSDHSGNYTCIASNVAGTERFTVPLTVNVPP 707
            :..|.||||.:  ..||.: .|...:..|.:.:|.:...|.|.|.|:|.||.:.....|.|.|.|
Human   266 AISWFRNGKLI--EENEKY-ILKGSNTELTVRNIINSDGGPYVCRATNKAGEDEKQAFLQVFVQP 327

  Fly   708 KWILEPKDSSAQAGADVLLHCQSSGYPTPTITWKKAIGPTPGEYKDFLYEPTVQL---FPNGTIF 769
            . |::.|:.:......|.|.|.:.|.|.|.||||:|:........|...:..:::   ..:.::.
Human   328 H-IIQLKNETTYENGQVTLVCDAEGEPIPEITWKRAVDGFTFTEGDKSLDGRIEVKGQHGSSSLH 391

  Fly   770 FKKISKESQGHFLCEAKNNIGSGVSKVIFLKVNVPAHFQTKTKQISVAKGKQVHVQCNVQGDNPI 834
            .|.:.....|.:.|||.:.|| |..|.::|.:.....|.:........:|..:::.|:|:.:.|.
Human   392 IKDVKLSDSGRYDCEAASRIG-GHQKSMYLDIEYAPKFISNQTIYYSWEGNPINISCDVKSNPPA 455

  Fly   835 DFKWKIQATQQYLDESLDSRYTIRDQVLDDGMVSELGISHTYRQDTGIYICQASNAFGQDEMSIQ 899
            ...|:....      .|.::.|...:....|....|.|:.|...|.|.|.|.|:|..|.......
Human   456 SIHWRRDKL------VLPAKNTTNLKTYSTGRKMILEIAPTSDNDFGRYNCTATNHIGTRFQEYI 514

  Fly   900 LIVQEVPEQPKNLRINSQQSRSLQLTWSQPFA-GNSPIEEYHIYYKQI-SDIWQNA-EHLTIAGA 961
            |.:.:||..|..::|......:.::::::|.: |..||..|.:..|:: |:||:.. .|    |.
Human   515 LALADVPSSPYGVKIIELSQTTAKVSFNKPDSHGGVPIHHYQVDVKEVASEIWKIVRSH----GV 575

  Fly   962 QTVINIQQLRPAKAYHIRMSAENKLGASEFSEVVQVTTLEEVPSGPPLAVRAEPKS--STEIFVT 1024
            ||::.:..|.|...|.||::|.|..|..::|::....||......|| ::..:|.|  |.::.:|
Human   576 QTMVVLNNLEPNTTYEIRVAAVNGKGQGDYSKIEIFQTLPVREPSPP-SIHGQPSSGKSFKLSIT 639

  Fly  1025 WDAPERDHWNGILLGYYVGYQMSLTPEDKEVNPTQGFSFKTVEVRSHFGGETVLANLNKFTQYHV 1089
                ::|.....:|.|.|.|:    .:|||   .|....|....:.|.    :|.:|.....|.|
Human   640 ----KQDDGGAPILEYIVKYR----SKDKE---DQWLEKKVQGNKDHI----ILEHLQWTMGYEV 689

  Fly  1090 IVQAYTSQG---------SGPPSKEIAVQTM 1111
            .:.|....|         |.||...|...|:
Human   690 QITAANRLGYSEPTVYEFSMPPKPNIIKDTL 720

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam4NP_001261571.1 Ig 31..124 CDD:472250
Ig strand B 50..54 CDD:409353
Ig strand C 63..66 CDD:409353
Ig strand E 82..86 CDD:409353
Ig strand F 102..107 CDD:409353
Ig strand G 115..119 CDD:409353
Ig 235..326 CDD:472250
Ig strand B 253..257 CDD:409353
Ig strand C 266..270 CDD:409353
Ig strand E 292..296 CDD:409353
Ig strand F 306..311 CDD:409353
Ig strand G 319..322 CDD:409353
IgC2_3_Dscam 329..417 CDD:409549 2/11 (18%)
Ig strand A 330..335 CDD:409549
Ig strand A' 338..342 CDD:409549
Ig strand B 345..355 CDD:409549
Ig strand C 360..366 CDD:409549
Ig strand C' 367..370 CDD:409549
Ig strand E 383..389 CDD:409549
Ig strand F 396..404 CDD:409549
Ig strand G 407..417 CDD:409549 1/9 (11%)
IgI_4_Dscam 422..516 CDD:409548 28/104 (27%)
Ig strand A' 430..434 CDD:409548 0/3 (0%)
Ig strand B 437..446 CDD:409548 1/8 (13%)
Ig strand C 451..457 CDD:409548 0/5 (0%)
Ig strand C' 459..462 CDD:409548 0/2 (0%)
Ig strand D 467..475 CDD:409548 1/7 (14%)
Ig strand E 479..488 CDD:409548 3/8 (38%)
Ig strand F 495..503 CDD:409548 4/7 (57%)
Ig strand G 506..516 CDD:409548 2/10 (20%)
IgI_5_Dscam 520..607 CDD:409550 21/96 (22%)
Ig strand A 520..522 CDD:409550 0/1 (0%)
Ig strand A' 527..531 CDD:409550 0/3 (0%)
Ig strand B 534..541 CDD:409550 2/6 (33%)
Ig strand C 548..554 CDD:409550 1/8 (13%)
Ig strand C' 555..557 CDD:409550 0/1 (0%)
Ig strand D 564..568 CDD:409550 0/3 (0%)
Ig strand E 571..577 CDD:409550 1/5 (20%)
Ig strand F 585..593 CDD:409550 3/7 (43%)
Ig strand G 597..607 CDD:409550 1/9 (11%)
Ig 610..703 CDD:472250 27/93 (29%)
Ig strand B 629..633 CDD:409353 0/3 (0%)
Ig strand C 643..647 CDD:409353 0/3 (0%)
Ig strand E 669..673 CDD:409353 1/3 (33%)
Ig strand F 683..688 CDD:409353 2/4 (50%)
Ig strand G 696..699 CDD:409353 0/2 (0%)
IgI_7_Dscam 706..801 CDD:409546 25/97 (26%)
Ig strand A 706..710 CDD:409546 1/3 (33%)
Ig strand A' 715..719 CDD:409546 0/3 (0%)
Ig strand B 722..731 CDD:409546 3/8 (38%)
Ig strand C 737..743 CDD:409546 4/5 (80%)
Ig strand C' 749..752 CDD:409546 0/2 (0%)
Ig strand D 760..763 CDD:409546 0/5 (0%)
Ig strand E 766..772 CDD:409546 0/5 (0%)
Ig strand F 779..787 CDD:409546 4/7 (57%)
Ig strand G 792..801 CDD:409546 3/8 (38%)
Ig 804..889 CDD:472250 17/84 (20%)
Ig strand B 822..826 CDD:409353 0/3 (0%)
Ig strand C 835..839 CDD:409353 0/3 (0%)
FN3 <850..1254 CDD:442628 70/276 (25%)
Ig strand F 882..887 CDD:409353 2/4 (50%)
FN3 906..999 CDD:238020 25/95 (26%)
fn3 1117..1203 CDD:394996
FN3 1185..>1580 CDD:442628
FN3 1405..1494 CDD:238020
NCAM2XP_011527877.1 IgI_1_NCAM-2 46..138 CDD:409452 26/97 (27%)
Ig strand A 46..51 CDD:409452 0/4 (0%)
Ig strand A' 54..58 CDD:409452 0/3 (0%)
Ig strand B 60..70 CDD:409452 2/9 (22%)
Ig strand C 74..80 CDD:409452 2/5 (40%)
Ig strand C' 83..85 CDD:409452 0/1 (0%)
Ig strand D 91..97 CDD:409452 1/5 (20%)
Ig strand E 99..107 CDD:409452 3/7 (43%)
Ig strand F 114..121 CDD:409452 3/6 (50%)
Ig strand G 126..137 CDD:409452 1/10 (10%)
Ig 142..218 CDD:472250 20/82 (24%)
Ig strand C 170..174 CDD:409353 0/3 (0%)
Ig strand E 193..197 CDD:409353 2/3 (67%)
IgI_1_MuSK 234..323 CDD:409562 26/92 (28%)
Ig strand A 234..237 CDD:409562 1/2 (50%)
Ig strand A' 242..247 CDD:409562 0/4 (0%)
Ig strand B 253..260 CDD:409562 2/7 (29%)
Ig strand C 266..271 CDD:409562 1/4 (25%)
Ig strand C' 273..275 CDD:409562 1/1 (100%)
Ig strand D 282..285 CDD:409562 0/3 (0%)
Ig strand E 289..295 CDD:409562 1/5 (20%)
Ig strand F 302..309 CDD:409562 3/6 (50%)
Ig strand G 315..323 CDD:409562 1/7 (14%)
IgI_NCAM-2 325..422 CDD:143278 26/98 (27%)
Ig strand A 325..330 CDD:143278 2/5 (40%)
Ig strand A' 334..338 CDD:143278 0/3 (0%)
Ig strand B 342..350 CDD:143278 3/7 (43%)
Ig strand C 356..362 CDD:143278 4/5 (80%)
Ig strand C' 365..368 CDD:143278 0/2 (0%)
Ig strand D 378..384 CDD:143278 0/5 (0%)
Ig strand E 387..393 CDD:143278 0/5 (0%)
Ig strand F 401..409 CDD:143278 4/7 (57%)
Ig strand G 412..422 CDD:143278 4/10 (40%)
Ig_3 426..504 CDD:464046 17/83 (20%)
FN3 521..613 CDD:238020 25/95 (26%)
fn3 619..703 CDD:394996 23/99 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.