DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam4 and dpr16

DIOPT Version :9

Sequence 1:NP_001261571.1 Gene:Dscam4 / 2769008 FlyBaseID:FBgn0263219 Length:1935 Species:Drosophila melanogaster
Sequence 2:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster


Alignment Length:437 Identity:96/437 - (21%)
Similarity:145/437 - (33%) Gaps:128/437 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   367 GKPILRDNRVEILTDPPRLIIKKVQKEDPGMYQCFVSNEWEQIQSTAELQLGDASPELLYWFSEQ 431
            |.|:|      :|.|..:      |:|    |...|.:.|.....||.|..|.:.|..|..|.| 
  Fly    84 GSPVL------MLGDDQQ------QQE----YDTTVVDSWSDRPDTATLTKGFSIPSYLPPFPE- 131

  Fly   432 TLQPGPTVSLKCVATGNPLPQFTWSLDGFPIP----DSSRFLVGQYVTIHDDVISHVNISNVKE- 491
             ..|.....:...|:....|.......|.|:|    :.||      :..:|.......:...|| 
  Fly   132 -FIPADLPHMLRNASSGAAPPADIGPSGSPMPSKPNEQSR------LHAYDSEQKAQQLRREKEL 189

  Fly   492 --------------------EDGGEYT---CTAQNAIGK--------------VSHSAKVNIYGL 519
                                ...|::.   |......||              |.|:..:|....
  Fly   190 AKERELLPRRQLSLPPLNATVQAGQHAYLPCKLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARF 254

  Fly   520 PYIREMPKITG-ISGSDL-IVKCPVAGYPIDKIHWERDGQTLPINRRQRAYNNGTLIIEQLQRLE 582
            ..:.:...:|. :||..| ....|||.......|....||    .|...:..:.||.|:.: .||
  Fly   255 ASLLQSTTLTTLVSGGALSTTATPVAALGNSFAHAVPGGQ----ERGNSSSLSWTLQIKYV-NLE 314

  Fly   583 DAGTYTCMAQNKQKQTSRRNVEIQV-LVPPKIMPIQAMTNMLREGMRAAISCQILEGDL--PVSF 644
            |||.|.|....:.|.:::    :|: ::.|:...|......::.|.|..:.| |:.|.|  |...
  Fly   315 DAGWYECQLATEPKMSAK----VQLFVITPRTELIGDRQRFVKAGSRVELHC-IVRGTLEAPKYI 374

  Fly   645 RWERNGKPLIGTGNEV-------FRRLD-------EYS----ASLVIEHISSDHSGNYTCIASNV 691
            .|.| |...:...||.       :.::|       |::    .||||..:...|||||||     
  Fly   375 FWYR-GDQQVTAENEASGAQSGWYTQIDRNIFGSTEHNRNTIGSLVIPLVRKIHSGNYTC----- 433

  Fly   692 AGTERFTVPLTVNVPPKWILEPKDSSAQAGADVLLHCQSSGYPTPTI 738
                                ||::|:|   |.:.||..|..|....|
  Fly   434 --------------------EPENSAA---ASMQLHVLSGEYSASAI 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam4NP_001261571.1 Ig 31..124 CDD:416386
Ig strand A 32..35 CDD:409353
Ig strand A' 41..45 CDD:409353
Ig strand B 48..57 CDD:409353
Ig strand D 75..78 CDD:409353
Ig strand E 83..88 CDD:409353
Ig strand F 101..109 CDD:409353
Ig strand G 112..124 CDD:409353
Ig 235..326 CDD:416386
Ig strand A 235..238 CDD:409353
Ig strand A' 244..248 CDD:409353
Ig strand B 251..258 CDD:409353
Ig strand C 266..271 CDD:409353
Ig strand C' 276..279 CDD:409353
Ig strand D 285..289 CDD:409353
Ig strand E 292..298 CDD:409353
Ig strand F 305..313 CDD:409353
Ig strand G 316..326 CDD:409353
IgC2_3_Dscam 329..417 CDD:409549 13/49 (27%)
Ig strand B 347..351 CDD:409549
Ig strand C 360..364 CDD:409549
Ig strand E 383..387 CDD:409549 0/3 (0%)
Ig strand F 397..402 CDD:409549 1/4 (25%)
Ig strand G 410..413 CDD:409549 0/2 (0%)
IgI_4_Dscam 422..516 CDD:409548 21/135 (16%)
Ig strand B 439..443 CDD:409548 0/3 (0%)
Ig strand C 452..456 CDD:409548 0/3 (0%)
Ig strand E 482..486 CDD:409548 0/3 (0%)
Ig strand F 496..501 CDD:409548 1/7 (14%)
Ig strand G 509..512 CDD:409548 1/2 (50%)
IgI_5_Dscam 520..607 CDD:409550 22/88 (25%)
Ig strand B 536..540 CDD:409550 1/4 (25%)
Ig strand C 549..553 CDD:409550 1/3 (33%)
Ig strand E 571..575 CDD:409550 2/3 (67%)
Ig strand F 586..591 CDD:409550 2/4 (50%)
Ig strand G 600..603 CDD:409550 0/2 (0%)
Ig 610..703 CDD:416386 27/112 (24%)
Ig strand A 611..613 CDD:409353 1/1 (100%)
Ig strand A' 620..624 CDD:409353 0/3 (0%)
Ig strand B 627..636 CDD:409353 2/8 (25%)
Ig strand C 641..648 CDD:409353 2/6 (33%)
Ig strand C' 650..652 CDD:409353 1/1 (100%)
Ig strand D 659..664 CDD:409353 1/11 (9%)
Ig strand E 668..675 CDD:409353 4/10 (40%)
Ig strand F 682..690 CDD:409353 5/7 (71%)
Ig strand G 693..702 CDD:409353 0/8 (0%)
IgI_7_Dscam 706..801 CDD:409546 10/33 (30%)
Ig strand B 724..728 CDD:409546 1/3 (33%)
Ig strand C 737..741 CDD:409546 1/2 (50%)
Ig strand E 766..770 CDD:409546
Ig strand F 780..785 CDD:409546
Ig strand G 794..797 CDD:409546
Ig 818..904 CDD:416386
putative Ig strand B 820..827 CDD:409353
putative Ig strand C 835..841 CDD:409353
putative Ig strand C' 853..856 CDD:409353
putative Ig strand D 862..866 CDD:409353
putative Ig strand E 868..874 CDD:409353
putative Ig strand F 881..889 CDD:409353
putative Ig strand G 892..902 CDD:409353
FN3 906..999 CDD:238020
FN3 1006..1110 CDD:238020
fn3 1117..1203 CDD:394996
FN3 1215..1307 CDD:238020
Ig <1334..1401 CDD:416386
Ig strand C 1345..1349 CDD:409353
Ig strand D 1363..1366 CDD:409353
Ig strand E 1367..1372 CDD:409353
Ig strand F 1380..1388 CDD:409353
Ig strand G 1394..1401 CDD:409353
FN3 1405..1494 CDD:238020
FN3 1499..1580 CDD:238020
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 30/140 (21%)
Ig <298..338 CDD:299845 12/44 (27%)
IG_like 352..447 CDD:214653 31/124 (25%)
Ig 358..439 CDD:143165 25/107 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.