DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam4 and IGLON5

DIOPT Version :9

Sequence 1:NP_001261571.1 Gene:Dscam4 / 2769008 FlyBaseID:FBgn0263219 Length:1935 Species:Drosophila melanogaster
Sequence 2:NP_001094842.1 Gene:IGLON5 / 402665 HGNCID:34550 Length:336 Species:Homo sapiens


Alignment Length:429 Identity:84/429 - (19%)
Similarity:132/429 - (30%) Gaps:159/429 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 AGLLKITKARLEDSGKYLCWVNNTAGEETIQVSLTVTAPLTAHLQPQVQTVDVDKDAQFQCIVSG 355
            |||..|::..|..|.::    |:.|..                     .||....:|...|.:..
Human    19 AGLAVISRGLLSQSLEF----NSPADN---------------------YTVCEGDNATLSCFIDE 58

  Fly   356 HPVHDVNWLHDGKPILRDN-------RVEILTDPPR---LIIKKVQKEDPGMYQCFVSNEWEQIQ 410
            | |..|.||:....:...|       ||.:|.:.|.   ::|.:|...|.|:|.|..... .|..
Human    59 H-VTRVAWLNRSNILYAGNDRWTSDPRVRLLINTPEEFSILITEVGLGDEGLYTCSFQTR-HQPY 121

  Fly   411 STAELQLGDASPELLYWFSEQTLQPGPTVSLKCVATGNPLPQFTWS--LDGFPIPDSSRFLVGQY 473
            :|....:......::...|..|:..|..|:|.|:|.|.|.|..||.  .|||             
Human   122 TTQVYLIVHVPARIVNISSPVTVNEGGNVNLLCLAVGRPEPTVTWRQLRDGF------------- 173

  Fly   474 VTIHDDVISHVNISNVKEEDGGEYTCTAQNAIGKVSHSAKVNIYGLPYIREMPKITGIS------ 532
             |...:::   .||:::....|||.|...|.:.....|.:|    |..:...|.||.::      
Human   174 -TSEGEIL---EISDIQRGQAGEYECVTHNGVNSAPDSRRV----LVTVNYPPTITDVTSARTAL 230

  Fly   533 GSDLIVKCPVAGYPIDKIHWERDGQTLPINRRQRAYNNGTLIIEQLQRLEDAGTYTCMAQNKQKQ 597
            |...:::|.....|.....|.:|                       .||..:||    |:..:.|
Human   231 GRAALLRCEAMAVPPADFQWYKD-----------------------DRLLSSGT----AEGLKVQ 268

  Fly   598 TSRRNVEIQVLVPPKIMPIQAMTNMLREGMRAAISCQILEGDLPVSFRWERNGKPLIGTGNEVFR 662
            |.|..                                                            
Human   269 TERTR------------------------------------------------------------ 273

  Fly   663 RLDEYSASLVIEHISSDHSGNYTCIASNVAGTERFTVPL 701
                  :.|:..::|:.|.|||||.|:|..|....::.|
Human   274 ------SMLLFANVSARHYGNYTCRAANRLGASSASMRL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam4NP_001261571.1 Ig 31..124 CDD:416386
Ig strand A 32..35 CDD:409353
Ig strand A' 41..45 CDD:409353
Ig strand B 48..57 CDD:409353
Ig strand D 75..78 CDD:409353
Ig strand E 83..88 CDD:409353
Ig strand F 101..109 CDD:409353
Ig strand G 112..124 CDD:409353
Ig 235..326 CDD:416386 8/34 (24%)
Ig strand A 235..238 CDD:409353
Ig strand A' 244..248 CDD:409353
Ig strand B 251..258 CDD:409353
Ig strand C 266..271 CDD:409353
Ig strand C' 276..279 CDD:409353
Ig strand D 285..289 CDD:409353
Ig strand E 292..298 CDD:409353 3/5 (60%)
Ig strand F 305..313 CDD:409353 0/7 (0%)
Ig strand G 316..326 CDD:409353 0/9 (0%)
IgC2_3_Dscam 329..417 CDD:409549 22/97 (23%)
Ig strand B 347..351 CDD:409549 1/3 (33%)
Ig strand C 360..364 CDD:409549 1/3 (33%)
Ig strand E 383..387 CDD:409549 1/6 (17%)
Ig strand F 397..402 CDD:409549 2/4 (50%)
Ig strand G 410..413 CDD:409549 0/2 (0%)
IgI_4_Dscam 422..516 CDD:409548 25/95 (26%)
Ig strand B 439..443 CDD:409548 2/3 (67%)
Ig strand C 452..456 CDD:409548 1/3 (33%)
Ig strand E 482..486 CDD:409548 0/3 (0%)
Ig strand F 496..501 CDD:409548 3/4 (75%)
Ig strand G 509..512 CDD:409548 0/2 (0%)
IgI_5_Dscam 520..607 CDD:409550 16/92 (17%)
Ig strand B 536..540 CDD:409550 0/3 (0%)
Ig strand C 549..553 CDD:409550 0/3 (0%)
Ig strand E 571..575 CDD:409550 0/3 (0%)
Ig strand F 586..591 CDD:409550 1/4 (25%)
Ig strand G 600..603 CDD:409550 1/2 (50%)
Ig 610..703 CDD:416386 12/92 (13%)
Ig strand A 611..613 CDD:409353 0/1 (0%)
Ig strand A' 620..624 CDD:409353 0/3 (0%)
Ig strand B 627..636 CDD:409353 0/8 (0%)
Ig strand C 641..648 CDD:409353 0/6 (0%)
Ig strand C' 650..652 CDD:409353 0/1 (0%)
Ig strand D 659..664 CDD:409353 0/4 (0%)
Ig strand E 668..675 CDD:409353 1/6 (17%)
Ig strand F 682..690 CDD:409353 6/7 (86%)
Ig strand G 693..702 CDD:409353 2/9 (22%)
IgI_7_Dscam 706..801 CDD:409546
Ig strand B 724..728 CDD:409546
Ig strand C 737..741 CDD:409546
Ig strand E 766..770 CDD:409546
Ig strand F 780..785 CDD:409546
Ig strand G 794..797 CDD:409546
Ig 818..904 CDD:416386
putative Ig strand B 820..827 CDD:409353
putative Ig strand C 835..841 CDD:409353
putative Ig strand C' 853..856 CDD:409353
putative Ig strand D 862..866 CDD:409353
putative Ig strand E 868..874 CDD:409353
putative Ig strand F 881..889 CDD:409353
putative Ig strand G 892..902 CDD:409353
FN3 906..999 CDD:238020
FN3 1006..1110 CDD:238020
fn3 1117..1203 CDD:394996
FN3 1215..1307 CDD:238020
Ig <1334..1401 CDD:416386
Ig strand C 1345..1349 CDD:409353
Ig strand D 1363..1366 CDD:409353
Ig strand E 1367..1372 CDD:409353
Ig strand F 1380..1388 CDD:409353
Ig strand G 1394..1401 CDD:409353
FN3 1405..1494 CDD:238020
FN3 1499..1580 CDD:238020
IGLON5NP_001094842.1 Ig 41..129 CDD:416386 22/110 (20%)
Ig strand A' 41..46 CDD:409353 2/25 (8%)
Ig strand B 48..56 CDD:409353 2/7 (29%)
CDR1 56..60 CDD:409353 1/4 (25%)
FR2 61..68 CDD:409353 3/6 (50%)
Ig strand C 61..67 CDD:409353 2/5 (40%)
CDR2 69..79 CDD:409353 1/9 (11%)
Ig strand C' 71..74 CDD:409353 0/2 (0%)
Ig strand C' 76..79 CDD:409353 1/2 (50%)
FR3 80..115 CDD:409353 10/34 (29%)
Ig strand D 84..91 CDD:409353 3/6 (50%)
Ig strand E 94..100 CDD:409353 0/5 (0%)
Ig strand F 107..115 CDD:409353 3/7 (43%)
CDR3 116..120 CDD:409353 0/4 (0%)
Ig strand G 120..129 CDD:409353 1/8 (13%)
FR4 122..129 CDD:409353 1/6 (17%)
Ig_3 134..199 CDD:404760 22/81 (27%)
Ig strand B 148..157 CDD:409353 3/8 (38%)
Ig strand C 162..170 CDD:409353 3/7 (43%)
Ig strand F 191..199 CDD:409353 4/7 (57%)
Ig strand G 202..212 CDD:409353 2/13 (15%)
Ig_3 217..295 CDD:404760 25/170 (15%)
putative Ig strand A 218..224 CDD:409353 3/5 (60%)
Ig strand B 234..238 CDD:409353 0/3 (0%)
Ig strand C 247..251 CDD:409353 0/3 (0%)
Ig strand E 274..278 CDD:409353 1/3 (33%)
Ig strand F 288..293 CDD:409353 4/4 (100%)
Ig strand G 301..304 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.