DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam4 and ImpL2

DIOPT Version :10

Sequence 1:NP_001261571.1 Gene:Dscam4 / 2769008 FlyBaseID:FBgn0263219 Length:1935 Species:Drosophila melanogaster
Sequence 2:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster


Alignment Length:355 Identity:73/355 - (20%)
Similarity:112/355 - (31%) Gaps:141/355 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDLHSLFKAILILYVIRAETSQFVNGLDLQGPI----------------------FLHEPPHRVE 43
            |:||....|:|:...|.....:.|:.:|....:                      |...||.:::
  Fly     5 MNLHVCALALLLFGSIATVRGRAVDLVDDSNDVDNSIEAEEEKPRNRAFEADWLKFTKTPPTKLQ 69

  Fly    44 FSNNSGGLIECSGHGSPPPEVEWTPIPPQQDMVFQLSNGSMMFYPFTAEKYRHEVHATVYRCKLR 108
            .::.:...|.|...||..|.::|                                          
  Fly    70 QADGATIEIVCEMMGSQVPSIQW------------------------------------------ 92

  Fly   109 NLVGTVLSREVHV-RGVVNQKYAVQVHDEYVMTGNTAVLKCQVPSYMSEFVLVTAWVQDTGMHLY 172
             :||       |: |..::...:.||.:|             .||         |.|:....|:.
  Fly    93 -VVG-------HLPRSELDDLDSNQVAEE-------------APS---------AIVRVRSSHII 127

  Fly   173 PNTDIGGKYTVLSNGELY--INNAGPNDAYKSYTCRTV------NRLTGEVQISTYPG----RII 225
            .:        |||....|  :...|....|.|    ||      :|||.|   .||||    |||
  Fly   128 DH--------VLSEARTYTCVGRTGSKTIYAS----TVVHPPRSSRLTPE---KTYPGAQKPRII 177

  Fly   226 VTEPKGMVQPRINVEKHSMRHVVLNGQT-TLPCIAQGHPVPTYRWFKEENEQLLPLQLSERITIV 289
            .||               ..|:.|.|.. .|||.....|.....|...||::::.   ..|..::
  Fly   178 YTE---------------KTHLDLMGSNIQLPCRVHARPRAEITWLNNENKEIVQ---GHRHRVL 224

  Fly   290 SAGLLKITKARLEDSGKYLCWVNNTAGEET 319
            :.|.|.|::.:.||.|.|.|...|..|::|
  Fly   225 ANGDLLISEIKWEDMGNYKCIARNVVGKDT 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam4NP_001261571.1 Ig 31..124 CDD:472250 13/115 (11%)
Ig strand B 50..54 CDD:409353 1/3 (33%)
Ig strand C 63..66 CDD:409353 0/2 (0%)
Ig strand E 82..86 CDD:409353 0/3 (0%)
Ig strand F 102..107 CDD:409353 0/4 (0%)
Ig strand G 115..119 CDD:409353 0/3 (0%)
Ig 235..326 CDD:472250 22/86 (26%)
Ig strand B 253..257 CDD:409353 1/4 (25%)
Ig strand C 266..270 CDD:409353 0/3 (0%)
Ig strand E 292..296 CDD:409353 2/3 (67%)
Ig strand F 306..311 CDD:409353 2/4 (50%)
Ig strand G 319..322 CDD:409353 1/1 (100%)
IgC2_3_Dscam 329..417 CDD:409549
Ig strand A 330..335 CDD:409549
Ig strand A' 338..342 CDD:409549
Ig strand B 345..355 CDD:409549
Ig strand C 360..366 CDD:409549
Ig strand C' 367..370 CDD:409549
Ig strand E 383..389 CDD:409549
Ig strand F 396..404 CDD:409549
Ig strand G 407..417 CDD:409549
IgI_4_Dscam 422..516 CDD:409548
Ig strand A' 430..434 CDD:409548
Ig strand B 437..446 CDD:409548
Ig strand C 451..457 CDD:409548
Ig strand C' 459..462 CDD:409548
Ig strand D 467..475 CDD:409548
Ig strand E 479..488 CDD:409548
Ig strand F 495..503 CDD:409548
Ig strand G 506..516 CDD:409548
IgI_5_Dscam 520..607 CDD:409550
Ig strand A 520..522 CDD:409550
Ig strand A' 527..531 CDD:409550
Ig strand B 534..541 CDD:409550
Ig strand C 548..554 CDD:409550
Ig strand C' 555..557 CDD:409550
Ig strand D 564..568 CDD:409550
Ig strand E 571..577 CDD:409550
Ig strand F 585..593 CDD:409550
Ig strand G 597..607 CDD:409550
Ig 610..703 CDD:472250
Ig strand B 629..633 CDD:409353
Ig strand C 643..647 CDD:409353
Ig strand E 669..673 CDD:409353
Ig strand F 683..688 CDD:409353
Ig strand G 696..699 CDD:409353
IgI_7_Dscam 706..801 CDD:409546
Ig strand A 706..710 CDD:409546
Ig strand A' 715..719 CDD:409546
Ig strand B 722..731 CDD:409546
Ig strand C 737..743 CDD:409546
Ig strand C' 749..752 CDD:409546
Ig strand D 760..763 CDD:409546
Ig strand E 766..772 CDD:409546
Ig strand F 779..787 CDD:409546
Ig strand G 792..801 CDD:409546
Ig 804..889 CDD:472250
Ig strand B 822..826 CDD:409353
Ig strand C 835..839 CDD:409353
FN3 <850..1254 CDD:442628
Ig strand F 882..887 CDD:409353
FN3 906..999 CDD:238020
fn3 1117..1203 CDD:394996
FN3 1185..>1580 CDD:442628
FN3 1405..1494 CDD:238020
ImpL2NP_728961.2 PHA02785 <74..246 CDD:165149 59/276 (21%)
Ig_3 173..248 CDD:464046 24/92 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.