DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam4 and LRIT3

DIOPT Version :9

Sequence 1:NP_001261571.1 Gene:Dscam4 / 2769008 FlyBaseID:FBgn0263219 Length:1935 Species:Drosophila melanogaster
Sequence 2:NP_940908.3 Gene:LRIT3 / 345193 HGNCID:24783 Length:679 Species:Homo sapiens


Alignment Length:667 Identity:128/667 - (19%)
Similarity:231/667 - (34%) Gaps:218/667 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   496 EYTCTAQNAIGKVSHSAKVNIYGLPYIREMPKITGISGSDLIVKCPVAGYP----IDKIHWERDG 556
            :|.....|::..:..|:..|:..|..:|       :.|:.|      |.:|    :|        
Human    84 QYLWVTYNSVASIDPSSFYNLKQLHELR-------LDGNSL------AAFPWASLLD-------- 127

  Fly   557 QTLPINRRQRAYNNGTLII--EQLQRLEDAGTYTCMAQNKQKQTSRRNVEIQVLVPPKIMPIQAM 619
              :|:.|....:||....:  |.|:.|::. .|..::.|:           ...:||..  :::.
Human   128 --MPLLRTLDLHNNKITSVPNEALRYLKNL-AYLDLSSNR-----------LTTLPPDF--LESW 176

  Fly   620 TNMLR--EGMRAAISCQILEG--DLPVSFRW--ERNGKPLIGTGNEVFRRLDEYSASLVIEHISS 678
            |:::.  .|:......:|:.|  |.|    |  :.:...:|    |:.:.:|  .|.::::.:  
Human   177 THLVSTPSGVLDLSPSRIILGLQDNP----WFCDCHISKMI----ELSKVVD--PAIVLLDPL-- 229

  Fly   679 DHSGNYTCIASNVAGTERFTVPLTVNVPPKWILEP-------KDSSAQAGADVLLHCQSSGYPTP 736
                 .||     :..||.|..|......:..|:|       |..|| .|::|||.|.::|:|||
Human   230 -----MTC-----SEPERLTGILFQRAELEHCLKPSVMTSATKIMSA-LGSNVLLRCDATGFPTP 283

  Fly   737 TITWKKAIGPTPGEYKDFLYEPTVQLFPN-----GTIFFKKISKESQGHFLCEAKNNIG--SGVS 794
            .|||.:: ..:|..|      ..:|..|.     ..:....||.:..|.:.|:|||..|  ..|.
Human   284 QITWTRS-DSSPVNY------TVIQESPEEGVRWSIMSLTGISSKDAGDYKCKAKNLAGMSEAVV 341

  Fly   795 KVIFLKVN---VPAHFQTKTKQISVAKGKQVHVQCNVQGDNPIDFKWKIQ----------ATQQY 846
            .|..|.:.   :|.....:|                  ||:|   :|.:|          :...|
Human   342 TVTVLGITTTPIPPDTSERT------------------GDHP---EWDVQPGSGRSTSVSSASSY 385

  Fly   847 L------------------------------DESLDSRYTIRDQV-------------LDDGMVS 868
            |                              ..::.|..|:...:             |..|...
Human   386 LWSSSFSPTSSFSASTLSPPSTASFSLSPFSSSTVSSTTTLSTSISASTTMANKRSFQLHQGGKR 450

  Fly   869 ELGISHTYRQDTGIYICQASNAFGQDEMSI--QLIVQEVPEQPKNLRINSQQSRSLQLTWSQ-PF 930
            .|.::     ..|..:..||.: .::|:::  |.::.|.....:|||:.|:...|:.|||:. ..
Human   451 NLKVA-----KNGSKLPPASTS-KKEELALLDQTMLTETNAAIENLRVVSETKESVTLTWNMINT 509

  Fly   931 AGNSPIEEYHIYYKQISDIWQNAE----HLTIAGAQ------TVINIQQLRPAKAYHIRMSAENK 985
            ..||.:...:..|.....:..||:    .:||.|.:      ..:..:.:.|.|...|..|.|..
Human   510 THNSAVTVLYSKYGGKDLLLLNADSSKNQVTIDGLEPGGQYMACVCPKGVPPQKDQCITFSTERV 574

  Fly   986 LG-ASEFSEVVQVTTLEEVPSGP----------PLAVRAEP------------------KSSTEI 1021
            .| .|::|.::.||:...|...|          .|..::||                  ..|..:
Human   575 EGDDSQWSLLLVVTSTACVVILPLICFLLYKVCKLQCKSEPFWEDDLAKETYIQFETLFPRSQSV 639

  Fly  1022 FVTWDAPERDHWNGILL 1038
            ...|....||....:||
Human   640 GELWTRSHRDDSEKLLL 656

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam4NP_001261571.1 Ig 31..124 CDD:416386
Ig strand A 32..35 CDD:409353
Ig strand A' 41..45 CDD:409353
Ig strand B 48..57 CDD:409353
Ig strand D 75..78 CDD:409353
Ig strand E 83..88 CDD:409353
Ig strand F 101..109 CDD:409353
Ig strand G 112..124 CDD:409353
Ig 235..326 CDD:416386
Ig strand A 235..238 CDD:409353
Ig strand A' 244..248 CDD:409353
Ig strand B 251..258 CDD:409353
Ig strand C 266..271 CDD:409353
Ig strand C' 276..279 CDD:409353
Ig strand D 285..289 CDD:409353
Ig strand E 292..298 CDD:409353
Ig strand F 305..313 CDD:409353
Ig strand G 316..326 CDD:409353
IgC2_3_Dscam 329..417 CDD:409549
Ig strand B 347..351 CDD:409549
Ig strand C 360..364 CDD:409549
Ig strand E 383..387 CDD:409549
Ig strand F 397..402 CDD:409549
Ig strand G 410..413 CDD:409549
IgI_4_Dscam 422..516 CDD:409548 3/19 (16%)
Ig strand B 439..443 CDD:409548
Ig strand C 452..456 CDD:409548
Ig strand E 482..486 CDD:409548
Ig strand F 496..501 CDD:409548 1/4 (25%)
Ig strand G 509..512 CDD:409548 0/2 (0%)
IgI_5_Dscam 520..607 CDD:409550 15/92 (16%)
Ig strand B 536..540 CDD:409550 1/3 (33%)
Ig strand C 549..553 CDD:409550 0/3 (0%)
Ig strand E 571..575 CDD:409550 0/3 (0%)
Ig strand F 586..591 CDD:409550 1/4 (25%)
Ig strand G 600..603 CDD:409550 0/2 (0%)
Ig 610..703 CDD:416386 19/98 (19%)
Ig strand A 611..613 CDD:409353 1/1 (100%)
Ig strand A' 620..624 CDD:409353 1/3 (33%)
Ig strand B 627..636 CDD:409353 0/8 (0%)
Ig strand C 641..648 CDD:409353 2/8 (25%)
Ig strand C' 650..652 CDD:409353 0/1 (0%)
Ig strand D 659..664 CDD:409353 1/4 (25%)
Ig strand E 668..675 CDD:409353 1/6 (17%)
Ig strand F 682..690 CDD:409353 2/7 (29%)
Ig strand G 693..702 CDD:409353 3/8 (38%)
IgI_7_Dscam 706..801 CDD:409546 32/108 (30%)
Ig strand B 724..728 CDD:409546 3/3 (100%)
Ig strand C 737..741 CDD:409546 2/3 (67%)
Ig strand E 766..770 CDD:409546 0/3 (0%)
Ig strand F 780..785 CDD:409546 1/4 (25%)
Ig strand G 794..797 CDD:409546 0/2 (0%)
Ig 818..904 CDD:416386 17/140 (12%)
putative Ig strand B 820..827 CDD:409353 0/6 (0%)
putative Ig strand C 835..841 CDD:409353 1/5 (20%)
putative Ig strand C' 853..856 CDD:409353 1/2 (50%)
putative Ig strand D 862..866 CDD:409353 1/3 (33%)
putative Ig strand E 868..874 CDD:409353 1/5 (20%)
putative Ig strand F 881..889 CDD:409353 2/7 (29%)
putative Ig strand G 892..902 CDD:409353 2/11 (18%)
FN3 906..999 CDD:238020 25/104 (24%)
FN3 1006..1110 CDD:238020 10/61 (16%)
fn3 1117..1203 CDD:394996
FN3 1215..1307 CDD:238020
Ig <1334..1401 CDD:416386
Ig strand C 1345..1349 CDD:409353
Ig strand D 1363..1366 CDD:409353
Ig strand E 1367..1372 CDD:409353
Ig strand F 1380..1388 CDD:409353
Ig strand G 1394..1401 CDD:409353
FN3 1405..1494 CDD:238020
FN3 1499..1580 CDD:238020
LRIT3NP_940908.3 LRR 1 56..79
leucine-rich repeat 59..82 CDD:275378
LRR_8 61..117 CDD:290566 7/39 (18%)
LRR 2 80..103 3/18 (17%)
leucine-rich repeat 83..106 CDD:275378 4/21 (19%)
LRR 3 104..128 7/46 (15%)
LRR_8 105..165 CDD:290566 16/94 (17%)
LRR_4 105..146 CDD:289563 11/63 (17%)
leucine-rich repeat 107..130 CDD:275378 7/45 (16%)
LRR 4 129..151 6/21 (29%)
LRR_4 131..170 CDD:289563 8/50 (16%)
leucine-rich repeat 131..154 CDD:275378 6/22 (27%)
LRR 5 152..175 5/36 (14%)
leucine-rich repeat 155..168 CDD:275378 2/24 (8%)
Ig 267..345 CDD:299845 26/84 (31%)
IG_like 267..345 CDD:214653 26/84 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 351..375 7/44 (16%)
FN3 486..550 CDD:214495 16/63 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.