DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam4 and CG44153

DIOPT Version :9

Sequence 1:NP_001261571.1 Gene:Dscam4 / 2769008 FlyBaseID:FBgn0263219 Length:1935 Species:Drosophila melanogaster
Sequence 2:NP_001097136.2 Gene:CG44153 / 34341 FlyBaseID:FBgn0265002 Length:1946 Species:Drosophila melanogaster


Alignment Length:1298 Identity:244/1298 - (18%)
Similarity:409/1298 - (31%) Gaps:440/1298 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 KCQVPSYMSEFVLVTAWVQDTGMHLYPNTDIGGKYTVLSNGELYINNAGPNDAYKS------YTC 205
            :|::|.........|:.......|...:.|..|: ::...|:.|..:.|..:|.:|      .|.
  Fly   292 RCEIPEINETTQGCTSNSSSIECHQACDFDNFGR-SISPPGQSYSASKGNRNAARSGKTRYEVTM 355

  Fly   206 RTVNRLTG------EVQISTYPGRIIVTEPKGMVQPRINVEKHSMRHVVLNGQTTLPCIAQGHPV 264
            |....|||      ..|:|.     ::....|.|....|:.|.|...::.|....|..       
  Fly   356 RLGANLTGYYRHADREQLSG-----VMERQLGRVLRNFNITKISDLELISNSTDRLDI------- 408

  Fly   265 PTYRWFKEENEQLLPLQLSERITIVSAGLLKITKARLEDSGKYLCWVNNTAGEETIQVSLTVTAP 329
             |:.:|..:.:       |:||.  .|....:.:.|:   |.:....|....:|...:.|   ..
  Fly   409 -TFHFFGVKGD-------SQRIR--DAITRMVERGRI---GNFTLVANFHHFDENPPLGL---LE 457

  Fly   330 LTAHLQPQVQTVDVDKDAQF--QCIVSGHPVHDVNWLHDGKPILRDNRV-EILTD--PPR----- 384
            ||.: |||   ..|.:.::|  .|...|.......|..||..:...... ||.|.  ||.     
  Fly   458 LTVN-QPQ---SGVREASEFIISCTAQGSSRMQFQWFKDGAVVNASKSTREIWTTVLPPETKDVY 518

  Fly   385 ---LIIKKVQKEDPGMYQCFVSNEW--EQ-------IQSTAELQLGDASPELLYWFSEQTLQPGP 437
               |.:.|..:.|.|:|.|.|: :|  ||       |:|...|::..||         .|||.|.
  Fly   519 TAILGVTKASRIDEGVYSCKVT-DWGVEQCRSLHIHIKSPPRLRVDPAS---------VTLQRGD 573

  Fly   438 TVSLKCVATGNPLPQ------FTWSLDGFPIPDSSRFLVGQYVTIHDDVISHVNISNVKEEDGGE 496
            ::.::|::.||...:      ::|:.:|  :...|......:..::.|. |.:.|:|:::  ..|
  Fly   574 SLRVRCLSPGNDDIKRYAQLGYSWTRNG--VLFQSDAATAMWEDLYPDG-SILKINNIQK--SAE 633

  Fly   497 YTCTAQNAIGKVSHSAKVNI--------------YGLPYIREMPKITGISGSDLIVKCPVAGYPI 547
            |.|...|::..||.|..:|:              ||:.:....|      ||.:|..|| .|:  
  Fly   634 YACLVSNSVRPVSRSVYINVIERNAVHVCPAESTYGVHWPTSAP------GSPIITDCP-RGF-- 689

  Fly   548 DKIHWERDGQTLPINRRQRAYNNGTLIIEQL------QRLEDAGTYTCMAQNKQKQTSRRNV--- 603
             :.|.:|..:       ||...|.|.::...      :.|.....:..::...| ||:..|:   
  Fly   690 -EGHLKRICE-------QRDTGNSTWLLPDFSGCVRDELLLIYNRFLALSAGFQ-QTNSSNILKA 745

  Fly   604 --EIQVLVPPKIMPIQA--MTNMLRE--------------GMRAAISCQILEGDLPVSFRWERNG 650
              |..:......:|.:|  :.:||.|              .|.|.|..:||:       :..:|.
  Fly   746 CFEFTLQRRHSFLPGEASFLIDMLHELDTYLQLKGTQLEREMAAEIILRILD-------KVMQNA 803

  Fly   651 KPLIGTGNEVFRRLDE--YSASLVIEHISSDHSGNYTCIASNVAGTERFTVPLTVNVPPKWILEP 713
            :.|  ...:..::|.:  .||:|..|.|::..      :|::.:|:.:   ||           |
  Fly   804 QSL--NSQQQIKKLQQLTQSAALNRETIAASQ------LATSTSGSSQ---PL-----------P 846

  Fly   714 KDSSAQ----AGADVLLHCQSSGYPTPTITWKKA--IGPTPGEYKDFL----------------- 755
            .|||.:    :|:.|... :.|..|..::...:|  .|..||.....|                 
  Fly   847 GDSSTRGDDGSGSGVTAG-EMSAAPAGSLQATRAGGAGGGPGGASSILTVDEDTLSLDRLNSLRI 910

  Fly   756 YEPTVQLFP------------------------------NGTIFFKKISKESQGHFLCEAKNNIG 790
            |..:|:..|                              |.|||...||.::...||.:.....|
  Fly   911 YMTSVKTLPFNLRIYGEDLFSDQLYMDIGLSSRLLHIMANSTIFASVISYKNLKSFLPKTYYTRG 975

  Fly   791 SG--------VSKVIFLKVNVPAHFQTKTKQISVAKGKQVHVQCNVQGDN---PIDFKWK---IQ 841
            |.        .|::|          ||..            .|.|...||   |:|..::   ::
  Fly   976 SDPRDSDYVLASRII----------QTWL------------FQSNRSNDNFREPLDLPFEAGHVE 1018

  Fly   842 ATQQYLDESLDSRYTIRDQVLDDGMVSELGISHTYRQDTGI----------YICQASNAFGQDEM 896
            ...|:  ||:..:   .|.|...|...:.....|:|.|..|          .||..|..:     
  Fly  1019 IIFQH--ESVPKK---GDWVAVCGHDYKASFDSTWRSDLCITKHLMANITRCICPLSGTY----- 1073

  Fly   897 SIQLIVQEVPEQPKNLRINSQQ------------------------------------------- 918
                :|.....||.....|:.:                                           
  Fly  1074 ----VVMLTKRQPNATPHNAPRRPIFVIASCACCLLQCGSALLILVPIWCNRKCAVTFLKMQFCV 1134

  Fly   919 -SRSLQLTWSQPFAGNSPIEEYHIYYKQISDIWQNAEHLTIAGAQTVINI-----QQLRPAKAYH 977
             :.|:.|.:...|....|:..:.|....::.       |.:.|..|:|.|     .:|.|.|...
  Fly  1135 STSSVMLIYLLGFMKMLPVSWHGIISSSLAS-------LLLLGISTLIAIALAIHTELMPKKYLQ 1192

  Fly   978 I-----------------------------------------RMSAENKLGASEFSEVVQVTTLE 1001
            |                                         ::.|::.|||:..|..:..||..
  Fly  1193 IGSKPATPTKRRLRREQERERERERDRDRERDRELDSLSNITQIRAQSPLGATTASTTITTTTSS 1257

  Fly  1002 EVPSGPPLAVRAEPKSST-----EIFVTWDAP-----------------ERDHWNGILLGYYVGY 1044
            ..|     ..|..|.|||     .|.::|..|                 .|..|..:|   :.| 
  Fly  1258 SNP-----GQRRPPPSSTAGMRGAIGISWLLPLLFAVAAPLICSIIGQWPRHWWLEVL---WTG- 1313

  Fly  1045 QMSLTPE----DKEVNPTQGFSFKTVEVRSHFGGETVLANLNKFTQYHVIVQAYTSQGSGPPSKE 1105
              |.:||    ..|...:...:|  ....|...|:.:|            :::....|:|..|..
  Fly  1314 --SASPEAGAGKDEAGDSDSGAF--YSAHSLLNGDNLL------------LESEAVMGNGTSSPP 1362

  Fly  1106 IAVQTMEDVPSSPPESPQCDVLGSTSIYITWSPPDIDGQNGKIKGYKVFYISVDELYETDPEV 1168
            ....:.....||...:...||..|||...:.......|.:....|...|..|......|...|
  Fly  1363 TETSSASSSSSSTGRAVDDDVATSTSSITSIGSASNSGFSASWSGITSFSTSTSTTSSTSTSV 1425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam4NP_001261571.1 Ig 31..124 CDD:416386
Ig strand A 32..35 CDD:409353
Ig strand A' 41..45 CDD:409353
Ig strand B 48..57 CDD:409353
Ig strand D 75..78 CDD:409353
Ig strand E 83..88 CDD:409353
Ig strand F 101..109 CDD:409353
Ig strand G 112..124 CDD:409353
Ig 235..326 CDD:416386 16/90 (18%)
Ig strand A 235..238 CDD:409353 0/2 (0%)
Ig strand A' 244..248 CDD:409353 0/3 (0%)
Ig strand B 251..258 CDD:409353 1/6 (17%)
Ig strand C 266..271 CDD:409353 1/4 (25%)
Ig strand C' 276..279 CDD:409353 0/2 (0%)
Ig strand D 285..289 CDD:409353 2/3 (67%)
Ig strand E 292..298 CDD:409353 0/5 (0%)
Ig strand F 305..313 CDD:409353 1/7 (14%)
Ig strand G 316..326 CDD:409353 2/9 (22%)
IgC2_3_Dscam 329..417 CDD:409549 30/109 (28%)
Ig strand B 347..351 CDD:409549 1/5 (20%)
Ig strand C 360..364 CDD:409549 0/3 (0%)
Ig strand E 383..387 CDD:409549 2/11 (18%)
Ig strand F 397..402 CDD:409549 2/4 (50%)
Ig strand G 410..413 CDD:409549 1/2 (50%)
IgI_4_Dscam 422..516 CDD:409548 21/99 (21%)
Ig strand B 439..443 CDD:409548 0/3 (0%)
Ig strand C 452..456 CDD:409548 0/9 (0%)
Ig strand E 482..486 CDD:409548 1/3 (33%)
Ig strand F 496..501 CDD:409548 3/4 (75%)
Ig strand G 509..512 CDD:409548 1/2 (50%)
IgI_5_Dscam 520..607 CDD:409550 19/97 (20%)
Ig strand B 536..540 CDD:409550 1/3 (33%)
Ig strand C 549..553 CDD:409550 1/3 (33%)
Ig strand E 571..575 CDD:409550 1/3 (33%)
Ig strand F 586..591 CDD:409550 0/4 (0%)
Ig strand G 600..603 CDD:409550 0/2 (0%)
Ig 610..703 CDD:416386 22/110 (20%)
Ig strand A 611..613 CDD:409353 0/1 (0%)
Ig strand A' 620..624 CDD:409353 1/3 (33%)
Ig strand B 627..636 CDD:409353 3/8 (38%)
Ig strand C 641..648 CDD:409353 0/6 (0%)
Ig strand C' 650..652 CDD:409353 0/1 (0%)
Ig strand D 659..664 CDD:409353 0/4 (0%)
Ig strand E 668..675 CDD:409353 3/6 (50%)
Ig strand F 682..690 CDD:409353 1/7 (14%)
Ig strand G 693..702 CDD:409353 2/8 (25%)
IgI_7_Dscam 706..801 CDD:409546 28/155 (18%)
Ig strand B 724..728 CDD:409546 1/3 (33%)
Ig strand C 737..741 CDD:409546 0/3 (0%)
Ig strand E 766..770 CDD:409546 2/3 (67%)
Ig strand F 780..785 CDD:409546 2/4 (50%)
Ig strand G 794..797 CDD:409546 1/2 (50%)
Ig 818..904 CDD:416386 20/101 (20%)
putative Ig strand B 820..827 CDD:409353 1/6 (17%)
putative Ig strand C 835..841 CDD:409353 1/8 (13%)
putative Ig strand C' 853..856 CDD:409353 0/2 (0%)
putative Ig strand D 862..866 CDD:409353 0/3 (0%)
putative Ig strand E 868..874 CDD:409353 0/5 (0%)
putative Ig strand F 881..889 CDD:409353 3/17 (18%)
putative Ig strand G 892..902 CDD:409353 0/9 (0%)
FN3 906..999 CDD:238020 22/182 (12%)
FN3 1006..1110 CDD:238020 23/129 (18%)
fn3 1117..1203 CDD:394996 12/52 (23%)
FN3 1215..1307 CDD:238020
Ig <1334..1401 CDD:416386
Ig strand C 1345..1349 CDD:409353
Ig strand D 1363..1366 CDD:409353
Ig strand E 1367..1372 CDD:409353
Ig strand F 1380..1388 CDD:409353
Ig strand G 1394..1401 CDD:409353
FN3 1405..1494 CDD:238020
FN3 1499..1580 CDD:238020
CG44153NP_001097136.2 EGF_CA <264..294 CDD:238011 0/1 (0%)
IG_like 467..554 CDD:214653 22/87 (25%)
Ig 474..551 CDD:143165 20/77 (26%)
IG_like 564..653 CDD:214653 23/102 (23%)
Ig 572..642 CDD:299845 15/74 (20%)
HRM 661..718 CDD:280888 15/73 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10075
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.