DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam4 and DIP-kappa

DIOPT Version :9

Sequence 1:NP_001261571.1 Gene:Dscam4 / 2769008 FlyBaseID:FBgn0263219 Length:1935 Species:Drosophila melanogaster
Sequence 2:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster


Alignment Length:666 Identity:138/666 - (20%)
Similarity:244/666 - (36%) Gaps:157/666 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 IAQGHPVP---TYRWFKEENE----QLLPLQLSERITIVSAGLLKI------TKARLEDSGKYL- 308
            :|..|.:|   |.|.|:.:.|    ||       .|||::...:.:      |.|.:...||:. 
  Fly     3 MAGPHRLPRPHTRRRFRLQAEFNVRQL-------AITIIATAAVTMLMTATPTLAEIPSKGKHTR 60

  Fly   309 CWVNNTAGEETIQVSLTVTAPLTAHLQPQVQTVDVDKDAQFQCIVSGHPVHDVNWLH-DGKPIL- 371
            .....||.|::       ..|..|.....| ||.|.:||...|:|.....:.|.|:. |.:.|| 
  Fly    61 LDTQQTAQEDS-------DFPRFAEPIANV-TVSVGRDALMACVVENLKGYKVAWVRVDTQTILS 117

  Fly   372 -------RDNRVEILTDPPR---LIIKKVQKEDPGMYQCFVSNE-------WEQIQSTAELQLGD 419
                   :::|:.:..:..|   |.||:|::.|.|.|.|.|:.:       :.|:.....:..|.
  Fly   118 IHHNVISQNSRISLTYNDHRSWYLHIKEVEETDRGWYMCQVNTDPMRSRKGYLQVVVPPIIVEGL 182

  Fly   420 ASPELLYWFSEQTLQPGPTVSLKCVATGNPLPQFTWSLDGFPIPDSSRFLV-GQYVTIHDDVISH 483
            .|       ::..::.|..:||.|.|.|.|.|...|..:     |....|: |::|.:.|..:.|
  Fly   183 TS-------NDMVVREGQNISLVCKARGYPEPYVMWRRE-----DGEEMLIGGEHVNVVDGELLH 235

  Fly   484 VNISNVKEEDGGEYTCTAQNAI-GKVSHSAKVNIYGLPYIREMPKITG-ISGSDLIVKCPVAGYP 546
              |:.|.......|.|.|.|.: ..:|....:.:...|.:....::.| ..|.|:|::|....||
  Fly   236 --ITKVSRLHMAAYLCVASNGVPPSISKRVHLRVQFPPMLSIPNQLEGAYLGQDVILECHTEAYP 298

  Fly   547 IDKIHWERDGQTLPINRRQRA---YNNGTLIIEQLQRLE---------DAGTYTCMAQNKQKQTS 599
            ....:|..:...:.|:...||   |...:.:....:.::         |.|||.|:|:|...:|.
  Fly   299 ASINYWTTERGDMIISDTSRAGDKYETTSTVSGYTKYMKLKIRAVGPNDFGTYRCVAKNSLGETD 363

  Fly   600 RRNVEIQVLVPPKIMPIQAMTNMLREGMRAAISCQILEGDLPVSFRWERNGKPLIGTGNEVFRRL 664
             .|:::..:..|....|..|:.:.|                  |:..:|..:....:.|    .|
  Fly   364 -GNIKLDEMPTPTTAIISEMSLLNR------------------SYDGKRRHRNKFDSAN----AL 405

  Fly   665 DEYSASLVIEHISSDHSGNYTCIASNVAGTERFTVPLTVNVPPKWILEPKDSSAQAG--ADVLLH 727
            .:|.    :|.......||.       ||.........|..||........|.||..  |.::|.
  Fly   406 PDYG----VEEWRDGAQGNN-------AGNNGDNNQTPVRNPPGAFHNSAGSLAQHNLLAKIMLG 459

  Fly   728 CQSSGYPTPTITWKKAIGPTP-GEYKDFLYEPTVQLF--------------PNG--TIFFKKISK 775
            .::..:.    .:|:.....| ...:.||:..|:.|.              ||.  |:.....:.
  Fly   460 IKTQSFG----IFKRLSSSLPLAAGQSFLWLSTLSLVSAPSRWRMSNVENRPNSPETVVNNDTAA 520

  Fly   776 ---ESQGHFLCEAKNNIGSGVSK---------VIFLKVNVPAHFQTKTKQISVAKGKQVHV---Q 825
               |::.|.:.|:.||..|.:::         .||...:.|....|:.:::...:.:...:   |
  Fly   521 ECWETRSHCVSESNNNNNSRITQRPPMWARHLRIFHIAHTPCGASTQYQRLCERQWQWQRLWQWQ 585

  Fly   826 CNVQGDNPIDFKWKIQ 841
            |        .:||:.|
  Fly   586 C--------QWKWQHQ 593

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam4NP_001261571.1 Ig 31..124 CDD:416386
Ig strand A 32..35 CDD:409353
Ig strand A' 41..45 CDD:409353
Ig strand B 48..57 CDD:409353
Ig strand D 75..78 CDD:409353
Ig strand E 83..88 CDD:409353
Ig strand F 101..109 CDD:409353
Ig strand G 112..124 CDD:409353
Ig 235..326 CDD:416386 19/81 (23%)
Ig strand A 235..238 CDD:409353
Ig strand A' 244..248 CDD:409353
Ig strand B 251..258 CDD:409353 138/666 (21%)
Ig strand C 266..271 CDD:409353 2/4 (50%)
Ig strand C' 276..279 CDD:409353 2/2 (100%)
Ig strand D 285..289 CDD:409353 2/3 (67%)
Ig strand E 292..298 CDD:409353 0/11 (0%)
Ig strand F 305..313 CDD:409353 2/8 (25%)
Ig strand G 316..326 CDD:409353 1/9 (11%)
IgC2_3_Dscam 329..417 CDD:409549 27/106 (25%)
Ig strand B 347..351 CDD:409549 1/3 (33%)
Ig strand C 360..364 CDD:409549 1/3 (33%)
Ig strand E 383..387 CDD:409549 2/6 (33%)
Ig strand F 397..402 CDD:409549 2/4 (50%)
Ig strand G 410..413 CDD:409549 0/2 (0%)
IgI_4_Dscam 422..516 CDD:409548 22/95 (23%)
Ig strand B 439..443 CDD:409548 2/3 (67%)
Ig strand C 452..456 CDD:409548 0/3 (0%)
Ig strand E 482..486 CDD:409548 1/3 (33%)
Ig strand F 496..501 CDD:409548 2/4 (50%)
Ig strand G 509..512 CDD:409548 1/2 (50%)
IgI_5_Dscam 520..607 CDD:409550 22/99 (22%)
Ig strand B 536..540 CDD:409550 1/3 (33%)
Ig strand C 549..553 CDD:409550 0/3 (0%)
Ig strand E 571..575 CDD:409550 0/3 (0%)
Ig strand F 586..591 CDD:409550 3/4 (75%)
Ig strand G 600..603 CDD:409550 0/2 (0%)
Ig 610..703 CDD:416386 14/92 (15%)
Ig strand A 611..613 CDD:409353 1/1 (100%)
Ig strand A' 620..624 CDD:409353 0/3 (0%)
Ig strand B 627..636 CDD:409353 0/8 (0%)
Ig strand C 641..648 CDD:409353 1/6 (17%)
Ig strand C' 650..652 CDD:409353 0/1 (0%)
Ig strand D 659..664 CDD:409353 0/4 (0%)
Ig strand E 668..675 CDD:409353 0/6 (0%)
Ig strand F 682..690 CDD:409353 2/7 (29%)
Ig strand G 693..702 CDD:409353 1/8 (13%)
IgI_7_Dscam 706..801 CDD:409546 24/125 (19%)
Ig strand B 724..728 CDD:409546 1/3 (33%)
Ig strand C 737..741 CDD:409546 0/3 (0%)
Ig strand E 766..770 CDD:409546 1/5 (20%)
Ig strand F 780..785 CDD:409546 1/4 (25%)
Ig strand G 794..797 CDD:409546 0/11 (0%)
Ig 818..904 CDD:416386 5/27 (19%)
putative Ig strand B 820..827 CDD:409353 1/9 (11%)
putative Ig strand C 835..841 CDD:409353 2/5 (40%)
putative Ig strand C' 853..856 CDD:409353
putative Ig strand D 862..866 CDD:409353
putative Ig strand E 868..874 CDD:409353
putative Ig strand F 881..889 CDD:409353
putative Ig strand G 892..902 CDD:409353
FN3 906..999 CDD:238020
FN3 1006..1110 CDD:238020
fn3 1117..1203 CDD:394996
FN3 1215..1307 CDD:238020
Ig <1334..1401 CDD:416386
Ig strand C 1345..1349 CDD:409353
Ig strand D 1363..1366 CDD:409353
Ig strand E 1367..1372 CDD:409353
Ig strand F 1380..1388 CDD:409353
Ig strand G 1394..1401 CDD:409353
FN3 1405..1494 CDD:238020
FN3 1499..1580 CDD:238020
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 24/92 (26%)
IG_like 82..174 CDD:214653 25/92 (27%)
IG_like 184..267 CDD:214653 23/96 (24%)
IGc2 191..255 CDD:197706 21/70 (30%)
IG_like 282..368 CDD:214653 20/86 (23%)
Ig 288..367 CDD:143165 18/79 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.