DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam4 and kirre

DIOPT Version :9

Sequence 1:NP_001261571.1 Gene:Dscam4 / 2769008 FlyBaseID:FBgn0263219 Length:1935 Species:Drosophila melanogaster
Sequence 2:NP_001245505.1 Gene:kirre / 31292 FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster


Alignment Length:534 Identity:120/534 - (22%)
Similarity:199/534 - (37%) Gaps:102/534 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   430 EQTLQPGPTVSLKCVATGNPLPQFTWSLDGFPIPDSSRFLVG--QYVTIHDDVIS--HVNISNVK 490
            :||...|..|:|.| .....:....|:.|.|.: ...|.|.|  :|..:..|...  .::|..:.
  Fly    90 DQTAVVGSRVTLPC-RVMEKVGALQWTKDDFGL-GQHRNLSGFERYSMVGSDEEGDFSLDIYPLM 152

  Fly   491 EEDGGEYTCTA----QNAIGKVSHSAKVNIYGLPYIREMPKITGISGSDLI--------VKC-PV 542
            .:|..:|.|..    |...|..|..||:.:...|   |.||||  .|..|:        ::| ..
  Fly   153 LDDDAKYQCQVGPGPQGEQGIRSRFAKLTVL
VPP---EAPKIT--QGDYLVTTEDREIELECVSQ 212

  Fly   543 AGYPIDKIHWERDG-------------QTLPINRRQRAYNNGTLIIEQLQRLEDAG-TYTCMAQN 593
            .|.|..:|.| .||             :.|..:||..|.:    |::...:.|... |:||.|||
  Fly   213 GGKPAAEITW-IDGLGNVLTKGIEYVKEPLADSRRITARS----ILKLAPKKEHHNTTFTCQAQN 272

  Fly   594 KQKQTSR-RNVEIQVLVPPKIMPIQAMTNMLR-----EGMRAAISCQILEGDLPVSFRWERNGKP 652
            ...:|.| ..:.::|...||:: :..:...|.     ||....:|||.......:|:||..|.:.
  Fly   273 TADRTYR
SAKLLLEVKYAPKVI-VSVVGGALAGGKIPEGAEVILSCQADANPHELSYRWFINDEL 336

  Fly   653 LIGTGNEVFRRLDEYSASLVIEHISSD-HSGNYTCIASNVAGTERFTVPLTVNVPPKWILEPKDS 716
            :.|          :::..::|.::|.. |.....|...|..|....:..|.::..|.:...|...
  Fly   337 MTG----------DFTTKMIIHNVSRQYHDAIVKCEVVNAVGKSEQSKKLDIS
FGPVFRQRPVSV 391

  Fly   717 SAQAGADVLLHCQSSGYPTPTITWKKAIGPTPGEYKDFLYEPTVQLFPNGTIFFKKISKESQGHF 781
            .|..||.|.:.|..:|.|.|.|.|              :.|.:.|:.........|:|.|:.|.:
  Fly   392 EADLGATVSMRCDVAGNPEPEIEW--------------ISENSDQVVGVAAELKLKVSSETAGRY 442

  Fly   782 LCEAKNNIG---SGVSKVIFLKVNVPAHFQTKTKQISVAKGKQVHVQCNVQGDNPIDFK------ 837
            .|:|..| |   .|....:::|   .|...|..|......|.:|.:.|       :.|.      
  Fly   443 FCKAVVN-GFPEIGAEATLYV
K---RAPIITSHKVQFGGVGGRVKIDC-------LAFSIPKAEH 496

  Fly   838 --WKIQATQQYLDESLDSRYTIRDQVLDDGMVSELGISHTYRQDTGIYICQASNAFGQDEMSIQL 900
              |..:.....:..:....|...:..|.:|:.:.|.|..:.....|.|.|...|::|.|.:.|.|
  Fly   497 ILWSFEGKIINMSSADPDIYIFEEHHLPEGVRAALIIRDSKATHFGKYNCTVMNSYGGDSLVITL 561

  Fly   901 IVQEVPEQPKNLRI 914
            :     .:|.|:.:
  Fly   562 L-----REPGNIPV 570

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam4NP_001261571.1 Ig 31..124 CDD:416386
Ig strand A 32..35 CDD:409353
Ig strand A' 41..45 CDD:409353
Ig strand B 48..57 CDD:409353
Ig strand D 75..78 CDD:409353
Ig strand E 83..88 CDD:409353
Ig strand F 101..109 CDD:409353
Ig strand G 112..124 CDD:409353
Ig 235..326 CDD:416386
Ig strand A 235..238 CDD:409353
Ig strand A' 244..248 CDD:409353
Ig strand B 251..258 CDD:409353
Ig strand C 266..271 CDD:409353
Ig strand C' 276..279 CDD:409353
Ig strand D 285..289 CDD:409353
Ig strand E 292..298 CDD:409353
Ig strand F 305..313 CDD:409353
Ig strand G 316..326 CDD:409353
IgC2_3_Dscam 329..417 CDD:409549
Ig strand B 347..351 CDD:409549
Ig strand C 360..364 CDD:409549
Ig strand E 383..387 CDD:409549
Ig strand F 397..402 CDD:409549
Ig strand G 410..413 CDD:409549
IgI_4_Dscam 422..516 CDD:409548 23/93 (25%)
Ig strand B 439..443 CDD:409548 2/3 (67%)
Ig strand C 452..456 CDD:409548 0/3 (0%)
Ig strand E 482..486 CDD:409548 0/5 (0%)
Ig strand F 496..501 CDD:409548 2/4 (50%)
Ig strand G 509..512 CDD:409548 1/2 (50%)
IgI_5_Dscam 520..607 CDD:409550 29/110 (26%)
Ig strand B 536..540 CDD:409550 1/11 (9%)
Ig strand C 549..553 CDD:409550 1/3 (33%)
Ig strand E 571..575 CDD:409550 0/3 (0%)
Ig strand F 586..591 CDD:409550 3/4 (75%)
Ig strand G 600..603 CDD:409550 1/3 (33%)
Ig 610..703 CDD:416386 20/98 (20%)
Ig strand A 611..613 CDD:409353 1/1 (100%)
Ig strand A' 620..624 CDD:409353 0/3 (0%)
Ig strand B 627..636 CDD:409353 3/8 (38%)
Ig strand C 641..648 CDD:409353 3/6 (50%)
Ig strand C' 650..652 CDD:409353 0/1 (0%)
Ig strand D 659..664 CDD:409353 0/4 (0%)
Ig strand E 668..675 CDD:409353 1/6 (17%)
Ig strand F 682..690 CDD:409353 1/7 (14%)
Ig strand G 693..702 CDD:409353 1/8 (13%)
IgI_7_Dscam 706..801 CDD:409546 23/97 (24%)
Ig strand B 724..728 CDD:409546 1/3 (33%)
Ig strand C 737..741 CDD:409546 1/3 (33%)
Ig strand E 766..770 CDD:409546 0/3 (0%)
Ig strand F 780..785 CDD:409546 1/4 (25%)
Ig strand G 794..797 CDD:409546 0/2 (0%)
Ig 818..904 CDD:416386 18/93 (19%)
putative Ig strand B 820..827 CDD:409353 1/6 (17%)
putative Ig strand C 835..841 CDD:409353 2/13 (15%)
putative Ig strand C' 853..856 CDD:409353 0/2 (0%)
putative Ig strand D 862..866 CDD:409353 1/3 (33%)
putative Ig strand E 868..874 CDD:409353 2/5 (40%)
putative Ig strand F 881..889 CDD:409353 3/7 (43%)
putative Ig strand G 892..902 CDD:409353 4/9 (44%)
FN3 906..999 CDD:238020 2/9 (22%)
FN3 1006..1110 CDD:238020
fn3 1117..1203 CDD:394996
FN3 1215..1307 CDD:238020
Ig <1334..1401 CDD:416386
Ig strand C 1345..1349 CDD:409353
Ig strand D 1363..1366 CDD:409353
Ig strand E 1367..1372 CDD:409353
Ig strand F 1380..1388 CDD:409353
Ig strand G 1394..1401 CDD:409353
FN3 1405..1494 CDD:238020
FN3 1499..1580 CDD:238020
kirreNP_001245505.1 Ig 87..183 CDD:299845 23/94 (24%)
IG_like 88..182 CDD:214653 23/93 (25%)
C2-set_2 189..279 CDD:285423 26/96 (27%)
Ig_2 307..379 CDD:290606 17/81 (21%)
I-set 382..462 CDD:254352 23/94 (24%)
IGc2 396..446 CDD:197706 16/63 (25%)
Ig 466..561 CDD:299845 19/101 (19%)
IG_like 478..561 CDD:214653 17/89 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.