DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam4 and dpr1

DIOPT Version :9

Sequence 1:NP_001261571.1 Gene:Dscam4 / 2769008 FlyBaseID:FBgn0263219 Length:1935 Species:Drosophila melanogaster
Sequence 2:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster


Alignment Length:389 Identity:80/389 - (20%)
Similarity:136/389 - (34%) Gaps:111/389 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1223 AIPASSSKIIISWLPPDLPNGDITGYTFYMSM--LEGGREEGTHKRLLGPFVEMHETVRTQESAT 1285
            ::|:.::..:::||         .|:...:||  |.|      :...|.|               
  Fly     2 SLPSRANIGLLNWL---------IGWLLLLSMVLLRG------YNAALAP--------------- 36

  Fly  1286 YQFWLTASTKMGEGEKTQVVTVPPNNKVPARIVSFSQRIVTPWKEHLELPCR--KVGAPAPVTIW 1348
                 |..|       |...|:.|:|.:|.......:.:.....:...|.||  ::|......|.
  Fly    37 -----TPPT-------TSTTTISPSNLLPYFDFDVPRNLTVTVGQTGFLHCRVERLGDKDVSWIR 89

  Fly  1349 RQDGHNMETSA------------RKTIAKNGTLYMKECQASDAGNYTCSVENTWGKDEIVYNI-V 1400
            ::|.|.:....            |...:.|.||.:|..|..|:|.|.|.: ||..|..:.|.. |
  Fly    90 KRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQI-NTEPKMSLSYTFNV 153

  Fly  1401 VKVPPE--APNLTVINAYTD-SLLLEWMDNSHGGSPILGYVINYKRD---NGDWEELQVDSKTTS 1459
            |::..|  .|:..::...:| :|..:.|...|.    ||.:..||..   :|..|. ::||....
  Fly   154 VELKAEIFGPSDLMVKTGSDINLTCKIMQGPHE----LGNIFWYKGSEMLDGKGEN-EIDSSMAR 213

  Fly  1460 HLLTNLWCGTRYQLYITAYNKIGTGLPCDIVNSYT----------------KGNPPVQPKHSQMI 1508
            ..:.:.|...     :|:..||...:|.|..| ||                .|..|...:|:...
  Fly   214 IRVEDDWTDG-----LTSRLKIKRAMPGDTGN-YTCVPTVAKTSSVYVHVIIGEHPAAMQHNSSS 272

  Fly  1509 TNNS----------TSVTCWLDSWGDGGCGILYFMIESRVYGRSSWAVVSNHIPPTERIYTVSD 1562
            .:||          :.|:|.|..:.:.|||.|        :..::.|..:...||.....|.|:
  Fly   273 NSNSFYCGICCMLLSIVSCCLQHFYETGCGYL--------HAAAALAKSAGLGPPKRATLTTSE 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam4NP_001261571.1 Ig 31..124 CDD:416386
Ig strand A 32..35 CDD:409353
Ig strand A' 41..45 CDD:409353
Ig strand B 48..57 CDD:409353
Ig strand D 75..78 CDD:409353
Ig strand E 83..88 CDD:409353
Ig strand F 101..109 CDD:409353
Ig strand G 112..124 CDD:409353
Ig 235..326 CDD:416386
Ig strand A 235..238 CDD:409353
Ig strand A' 244..248 CDD:409353
Ig strand B 251..258 CDD:409353
Ig strand C 266..271 CDD:409353
Ig strand C' 276..279 CDD:409353
Ig strand D 285..289 CDD:409353
Ig strand E 292..298 CDD:409353
Ig strand F 305..313 CDD:409353
Ig strand G 316..326 CDD:409353
IgC2_3_Dscam 329..417 CDD:409549
Ig strand B 347..351 CDD:409549
Ig strand C 360..364 CDD:409549
Ig strand E 383..387 CDD:409549
Ig strand F 397..402 CDD:409549
Ig strand G 410..413 CDD:409549
IgI_4_Dscam 422..516 CDD:409548
Ig strand B 439..443 CDD:409548
Ig strand C 452..456 CDD:409548
Ig strand E 482..486 CDD:409548
Ig strand F 496..501 CDD:409548
Ig strand G 509..512 CDD:409548
IgI_5_Dscam 520..607 CDD:409550
Ig strand B 536..540 CDD:409550
Ig strand C 549..553 CDD:409550
Ig strand E 571..575 CDD:409550
Ig strand F 586..591 CDD:409550
Ig strand G 600..603 CDD:409550
Ig 610..703 CDD:416386
Ig strand A 611..613 CDD:409353
Ig strand A' 620..624 CDD:409353
Ig strand B 627..636 CDD:409353
Ig strand C 641..648 CDD:409353
Ig strand C' 650..652 CDD:409353
Ig strand D 659..664 CDD:409353
Ig strand E 668..675 CDD:409353
Ig strand F 682..690 CDD:409353
Ig strand G 693..702 CDD:409353
IgI_7_Dscam 706..801 CDD:409546
Ig strand B 724..728 CDD:409546
Ig strand C 737..741 CDD:409546
Ig strand E 766..770 CDD:409546
Ig strand F 780..785 CDD:409546
Ig strand G 794..797 CDD:409546
Ig 818..904 CDD:416386
putative Ig strand B 820..827 CDD:409353
putative Ig strand C 835..841 CDD:409353
putative Ig strand C' 853..856 CDD:409353
putative Ig strand D 862..866 CDD:409353
putative Ig strand E 868..874 CDD:409353
putative Ig strand F 881..889 CDD:409353
putative Ig strand G 892..902 CDD:409353
FN3 906..999 CDD:238020
FN3 1006..1110 CDD:238020
fn3 1117..1203 CDD:394996
FN3 1215..1307 CDD:238020 13/85 (15%)
Ig <1334..1401 CDD:416386 21/81 (26%)
Ig strand C 1345..1349 CDD:409353 1/3 (33%)
Ig strand D 1363..1366 CDD:409353 0/2 (0%)
Ig strand E 1367..1372 CDD:409353 2/4 (50%)
Ig strand F 1380..1388 CDD:409353 3/7 (43%)
Ig strand G 1394..1401 CDD:409353 1/7 (14%)
FN3 1405..1494 CDD:238020 21/94 (22%)
FN3 1499..1580 CDD:238020 16/74 (22%)
dpr1NP_001286645.1 Ig 59..154 CDD:299845 21/95 (22%)
IG_like 60..150 CDD:214653 20/90 (22%)
IG_like 163..257 CDD:214653 22/104 (21%)
Ig 174..244 CDD:143165 20/80 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.