DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam4 and IGSF9B

DIOPT Version :10

Sequence 1:NP_001261571.1 Gene:Dscam4 / 2769008 FlyBaseID:FBgn0263219 Length:1935 Species:Drosophila melanogaster
Sequence 2:NP_001264214.1 Gene:IGSF9B / 22997 HGNCID:32326 Length:1437 Species:Homo sapiens


Alignment Length:1313 Identity:262/1313 - (19%)
Similarity:445/1313 - (33%) Gaps:441/1313 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 QPQVQTVDVDKDAQFQCIVSGHPV------HDVNWLHDGKPI-------LRDNRVE-------IL 379
            :|:..|....:....:|.|. |||      :.|.|...|.||       .....|:       .|
Human    29 EPEFVTARAGESVVLRCDVI-HPVTGQPPPYVVEWFKFGVPIPIFIKFGYYPPHVDPEYAGRASL 92

  Fly   380 TDPPRLIIKKVQKEDPGMYQC-----------FVSNEWEQIQSTAELQLGDASPELLYWFSEQTL 433
            .|...|.:::|:.||.|.|:|           |.:..|..:...|.....:..|:.:      ..
Human    93 HDKASLRLEQVRSEDQGWYECKVLMLDQQYDTFHNGSWVHLTINAPPTFTETPPQYI------EA 151

  Fly   434 QPGPTVSLKCVATGNPLPQFTWSLDGFPIPDSSRFLVGQYVTIHDDVISHVNISNVKEEDGGEYT 498
            :.|.::::.|.|.|||.|..||..:|..:..|.::.|..         ..:.:::|..||.|.||
Human   152 KEGGSITMTCTAFGNPKPIVTWLKEGTLLGASGKYQVSD---------GSLTVTSVSREDRGAYT 207

  Fly   499 CTAQNAIGKVSHSAKVNIYGLPYIREMPK-ITGISGSDLIVKCPVAGYP----------IDKIHW 552
            |.|.:..|:..|:..:.:.|.|:|...|: ||.....|.::.|....||          .:.:::
Human   208 CRAYSIQGEAVHTTHLLVQGPPFIVSPPENITVNISQDALLTCRAEAYPGNLTYTWYWQDENVYF 272

  Fly   553 ERDGQTLPINRRQRAYNNGTLIIEQLQRLEDAGTYTCMAQNKQKQTSRRNVEIQVLVPPKIMPIQ 617
            :.|     :..|.|...:|||||.:: :.||:|.|||:..|...::...:..:.|..|.:::   
Human   273 QND-----LKLRVRILIDGTLIIFRV-KPEDSGKYTCVPSNSLGRSPSASAYLTVQYPARVL--- 328

  Fly   618 AMTNM-----LREGMRAAISCQILEGDLPVS-FRWERNGKPLIGTGNEVFRRLDEYSASLVIEHI 676
               ||     :..|:...|.|.: :.:.|.: .:|.::|:||....|..:..:::  .|:.||..
Human   329 ---NMPPVIYVPVGIHGYIRCPV-DAEPPATVVKWNKDGRPLQVEKNLGWTLMED--GSIRIEEA 387

  Fly   677 SSDHSGNYTCIASNVAGTERFTVP--LTVNVPPKWILEPK-DSSAQAGADVLLHCQSSGYPTPTI 738
            :.:..|.|||:..|..||...:.|  |.:..||.:.:.|. :...:||.::|:.|.::|.|.|.|
Human   388 TEEALGTYTCVPYNTLGTMGQSAPARLVLKDPPYFTVLPGWEYRQEAGRELLIPCAAAGDPFPVI 452

  Fly   739 TWKKAIGPTPGEYKDFLYEPTVQLFPNGTIFFKKISKESQGHFLCEAKNNIGSGVSKVIFLKVNV 803
            ||:|...|:..::         ...|:|::.|:.:|||..|.:.|.|.|.:.|         :..
Human   453 TWRKVGKPSRSKH---------SALPSGSLQFRALSKEDHGEWECVATNVVTS---------ITA 499

  Fly   804 PAHFQTKTKQISVAKGKQVHVQCNVQGDNPIDFKWKIQATQQYLDESLDSRYTIRDQVLDDGMVS 868
            ..|                                                            ::
Human   500 STH------------------------------------------------------------LT 504

  Fly   869 ELGISHTYRQDTGIYICQASNAFGQDEMSIQLIVQEVPEQPKNLRINSQQSRSLQLTWSQPFAGN 933
            .:|.|                                |..|.::|:....: :..::|...:.|.
Human   505 VIGTS--------------------------------PHAPGSVRVQVSMT-TANVSWEPGYDGG 536

  Fly   934 SPIEEYHIYYKQISDIW----QNAEH----LTIAGAQTVINIQQLRPAKAYHIRMSAENKLGASE 990
                     |:|...:|    |...|    |.:....:.:.:..|.|..||...:.|:||||.|.
Human   537 ---------YEQTFSVWMKRAQFGPHDWLSLPVPPGPSWLLVDTLEPETAYQFSVLAQNKLGTSA 592

  Fly   991 FSEVVQVTTLE-EVPSGPPLAVRAEP------KSSTEIFVTWDAPERDHWNGI---LLGYYVGYQ 1045
            |||||.|.||. .:.:..||.:...|      ::...:.::| .|..:|...|   ::.:.|..:
Human   593 FSEVVTVNTLAFPITTPEPLVLVTPPRCLIANRTQQGVLLSW-LPPANHSFPIDRYIMEFRVAER 656

  Fly  1046 MSLTPEDKEVNPTQGFSFKTVEVRSHFGGETVLANLNKFTQYHVIVQAYTSQGSGPPSKEIAVQT 1110
            ..|.  |..:..|:              ||....:|::.|.|...|.|........||....|.:
Human   657 WELL--DDGIPGTE--------------GEFFAKDLSQDTWYEFRVLAVMQDLISEPSNIAGVSS 705

  Fly  1111 MEDVP-------------------------------------------------SSPP------- 1119
            .:..|                                                 ..||       
Human   706 TDIFPQPDLTEDGLARPVLAGIVATICFLAAAILFSTLAACFVNKQRKRKLKRKKDPPLSITHCR 770

  Fly  1120 ---ESP-QCDVLGSTSIYITWSPPDIDGQNGKIKGYKVFYISVDELYETDPEVVKSTNQYVTIEN 1180
               ||| ....:...||....:|.:.....|:....::    :....|.:..:.|.|.:.:   :
Human   771 KSLESPLSSGKVSPESIRTLRAPSESSDDQGQPAAKRM----LSPTREKELSLYKKTKRAI---S 828

  Fly  1181 LRKYT--------NYTVWVLAYTKVGDG------------MKTK-----PFYCRT---------- 1210
            .:||:        ..|..:...::..||            :|::     ||...|          
Human   829 SKKYSVAKAEAEAEATTPIELISRGPDGRFVMDPAEMEPSLKSRRIEGFPFAEETDMYPEFRQSD 893

  Fly  1211 --HED--VPSAPQAIKA--IPASSSKIIISWLPPDL------PNGDITGYTFYMSMLEG-GREEG 1262
              :||  ||::..|:|:  .|.|||:  .|:|||..      |.|           ||| |..||
Human   894 EENEDPLVPTSVAALKSQLTPLSSSQ--ESYLPPPAYSPRFQPRG-----------LEGPGGLEG 945

  Fly  1263 THKRLLGPFVEMHETVRTQESATYQFWLTASTKMGEGEKTQVVTVPPNNKVPARIVSFSQRIVTP 1327
               ||...........|......|..:|::|:. ||.|       ||...||        .:.:|
Human   946 ---RLQATGQARPPAPRPFHHGQYYGYLSSSSP-GEVE-------PPPFYVP--------EVGSP 991

  Fly  1328 WKEHLELPCRKVGAPAPV-------TIWRQDGHNMETSARKTIAKNGTLYMKECQASDAGNYTCS 1385
            ....:..|      |.|.       ||..::|.|         |.|.||.:.:.......     
Human   992 LSSVMSSP------PLPTEGPFGHPTIPEENGEN---------ASNSTLPLTQTPTGGRS----- 1036

  Fly  1386 VENTWGKDEIVY-----------------NIVVKVPPEA--------PNLTVINAYTDSLLLE-- 1423
             ...||:.|..:                 ::...:.|:|        .:|.|..||...|.||  
Human  1037 -PEPWGRPEFPFGGLETPAMMFPHQLPPCDVPESLQPKAGLPRGLPPTSLQVPAAYPGILSLEAP 1100

  Fly  1424 --WMDNSHGGSPI 1434
              |...|.|..|:
Human  1101 KGWAGKSPGRGPV 1113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam4NP_001261571.1 Ig 31..124 CDD:472250
Ig strand B 50..54 CDD:409353
Ig strand C 63..66 CDD:409353
Ig strand E 82..86 CDD:409353
Ig strand F 102..107 CDD:409353
Ig strand G 115..119 CDD:409353
Ig 235..326 CDD:472250
Ig strand B 253..257 CDD:409353
Ig strand C 266..270 CDD:409353
Ig strand E 292..296 CDD:409353
Ig strand F 306..311 CDD:409353
Ig strand G 319..322 CDD:409353
IgC2_3_Dscam 329..417 CDD:409549 25/112 (22%)
Ig strand A 330..335 CDD:409549 262/1313 (20%)
Ig strand A' 338..342 CDD:409549 1/3 (33%)
Ig strand B 345..355 CDD:409549 2/9 (22%)
Ig strand C 360..366 CDD:409549 2/5 (40%)
Ig strand C' 367..370 CDD:409549 1/2 (50%)
Ig strand E 383..389 CDD:409549 1/5 (20%)
Ig strand F 396..404 CDD:409549 4/18 (22%)
Ig strand G 407..417 CDD:409549 1/9 (11%)
IgI_4_Dscam 422..516 CDD:409548 23/93 (25%)
Ig strand A' 430..434 CDD:409548 0/3 (0%)
Ig strand B 437..446 CDD:409548 1/8 (13%)
Ig strand C 451..457 CDD:409548 3/5 (60%)
Ig strand C' 459..462 CDD:409548 1/2 (50%)
Ig strand D 467..475 CDD:409548 1/7 (14%)
Ig strand E 479..488 CDD:409548 0/8 (0%)
Ig strand F 495..503 CDD:409548 5/7 (71%)
Ig strand G 506..516 CDD:409548 2/9 (22%)
IgI_5_Dscam 520..607 CDD:409550 24/97 (25%)
Ig strand A 520..522 CDD:409550 1/1 (100%)
Ig strand A' 527..531 CDD:409550 2/4 (50%)
Ig strand B 534..541 CDD:409550 1/6 (17%)
Ig strand C 548..554 CDD:409550 0/5 (0%)
Ig strand C' 555..557 CDD:409550 1/1 (100%)
Ig strand D 564..568 CDD:409550 2/3 (67%)
Ig strand E 571..577 CDD:409550 5/5 (100%)
Ig strand F 585..593 CDD:409550 4/7 (57%)
Ig strand G 597..607 CDD:409550 0/9 (0%)
Ig 610..703 CDD:472250 24/100 (24%)
Ig strand B 629..633 CDD:409353 1/3 (33%)
Ig strand C 643..647 CDD:409353 0/4 (0%)
Ig strand E 669..673 CDD:409353 1/3 (33%)
Ig strand F 683..688 CDD:409353 3/4 (75%)
Ig strand G 696..699 CDD:409353 0/2 (0%)
IgI_7_Dscam 706..801 CDD:409546 26/95 (27%)
Ig strand A 706..710 CDD:409546 2/3 (67%)
Ig strand A' 715..719 CDD:409546 0/3 (0%)
Ig strand B 722..731 CDD:409546 2/8 (25%)
Ig strand C 737..743 CDD:409546 3/5 (60%)
Ig strand C' 749..752 CDD:409546 0/2 (0%)
Ig strand D 760..763 CDD:409546 0/2 (0%)
Ig strand E 766..772 CDD:409546 2/5 (40%)
Ig strand F 779..787 CDD:409546 3/7 (43%)
Ig strand G 792..801 CDD:409546 0/8 (0%)
Ig 804..889 CDD:472250 3/84 (4%)
Ig strand B 822..826 CDD:409353 0/3 (0%)
Ig strand C 835..839 CDD:409353 0/3 (0%)
FN3 <850..1254 CDD:442628 90/528 (17%)
Ig strand F 882..887 CDD:409353 0/4 (0%)
FN3 906..999 CDD:238020 27/100 (27%)
fn3 1117..1203 CDD:394996 17/116 (15%)
FN3 1185..>1580 CDD:442628 70/334 (21%)
FN3 1405..1494 CDD:238020 13/42 (31%)
IGSF9BNP_001264214.1 IG_like 30..115 CDD:214653 22/85 (26%)
Ig strand B 41..45 CDD:409353 0/3 (0%)
Ig strand C 59..63 CDD:409353 1/3 (33%)
Ig strand E 96..100 CDD:409353 1/3 (33%)
Ig strand F 110..115 CDD:409353 2/4 (50%)
I-set 139..225 CDD:400151 23/100 (23%)
Ig strand B 157..161 CDD:409353 0/3 (0%)
Ig strand C 170..174 CDD:409353 1/3 (33%)
Ig strand E 191..195 CDD:409353 0/3 (0%)
Ig strand F 205..210 CDD:409353 3/4 (75%)
Ig strand G 218..221 CDD:409353 1/2 (50%)
Ig_3 228..307 CDD:464046 23/84 (27%)
Ig 336..410 CDD:472250 19/76 (25%)
Ig strand B 342..346 CDD:409353 1/3 (33%)
Ig strand C 355..360 CDD:409353 0/4 (0%)
Ig strand E 380..384 CDD:409353 1/3 (33%)
Ig strand F 394..399 CDD:409353 3/4 (75%)
Ig strand G 407..410 CDD:409353 0/2 (0%)
Ig 429..505 CDD:472250 24/153 (16%)
Ig strand B 438..442 CDD:409353 1/3 (33%)
Ig strand C 451..455 CDD:409353 2/3 (67%)
Ig strand E 471..475 CDD:409353 1/3 (33%)
Ig strand F 485..490 CDD:409353 1/4 (25%)
FN3 <490..>731 CDD:442628 57/368 (15%)
Ig strand G 498..501 CDD:409353 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 758..817 10/62 (16%)
PHA03247 <894..1242 CDD:223021 63/273 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 911..1081 46/222 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.