DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam4 and zig-2

DIOPT Version :10

Sequence 1:NP_001261571.1 Gene:Dscam4 / 2769008 FlyBaseID:FBgn0263219 Length:1935 Species:Drosophila melanogaster
Sequence 2:NP_510069.1 Gene:zig-2 / 192087 WormBaseID:WBGene00006979 Length:238 Species:Caenorhabditis elegans


Alignment Length:230 Identity:60/230 - (26%)
Similarity:85/230 - (36%) Gaps:49/230 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   404 NEWEQIQSTAELQLGDASPELLYWFSEQTLQP-------GPTVSLKCVATGNPLPQFTWSLDGFP 461
            |..|.:.....::..|:.|.|.:     |..|       |....|.|.|.|.|||...|.|:|..
 Worm    13 NAAESVDHQKPIRALDSQPLLKF-----TRTPNDSNVTFGEKFVLSCGANGAPLPSIYWELNGMR 72

  Fly   462 IPDSSRFLVGQYVTIHDD---------VISHVNISNVKEEDGGEYTCTAQNAIGKVSHSAKV--- 514
            |.......|  |..|.:|         |.||..|......:.|.|.|...|.:.|:.|.|||   
 Worm    73 IQGEETSNV--YENILNDGKQVSNAAMVSSHYRIPCATARNSGAYKCIIDNGLTKLEHVAKVFVG 135

  Fly   515 --------NIYGLPYIREMPKIT-----GISGSDLIVKCPVAGYPIDKIHWERDGQTLPIN--RR 564
                    |..|.|:|    .:|     .||.:.:.:.|  ......:..|.: |:.|..|  .|
 Worm   136 GNKTNCALNDNGAPFI----SMTVDFRLEISNNAVALSC--RSETATEWSWHK-GEQLLTNDGER 193

  Fly   565 QRAYNNGTLIIEQLQRLEDAGTYTCMAQNKQKQTS 599
            .:.:.:|.|||..:. ..|.|.|.|.|:|...:|:
 Worm   194 YQMFPSGDLIIRNIS-WSDMGEYNCTARNHFGETT 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam4NP_001261571.1 Ig 31..124 CDD:472250
Ig strand B 50..54 CDD:409353
Ig strand C 63..66 CDD:409353
Ig strand E 82..86 CDD:409353
Ig strand F 102..107 CDD:409353
Ig strand G 115..119 CDD:409353
Ig 235..326 CDD:472250
Ig strand B 253..257 CDD:409353
Ig strand C 266..270 CDD:409353
Ig strand E 292..296 CDD:409353
Ig strand F 306..311 CDD:409353
Ig strand G 319..322 CDD:409353
IgC2_3_Dscam 329..417 CDD:409549 2/12 (17%)
Ig strand A 330..335 CDD:409549
Ig strand A' 338..342 CDD:409549
Ig strand B 345..355 CDD:409549
Ig strand C 360..366 CDD:409549
Ig strand C' 367..370 CDD:409549
Ig strand E 383..389 CDD:409549
Ig strand F 396..404 CDD:409549 60/230 (26%)
Ig strand G 407..417 CDD:409549 1/9 (11%)
IgI_4_Dscam 422..516 CDD:409548 33/120 (28%)
Ig strand A' 430..434 CDD:409548 1/3 (33%)
Ig strand B 437..446 CDD:409548 2/8 (25%)
Ig strand C 451..457 CDD:409548 2/5 (40%)
Ig strand C' 459..462 CDD:409548 1/2 (50%)
Ig strand D 467..475 CDD:409548 2/7 (29%)
Ig strand E 479..488 CDD:409548 5/17 (29%)
Ig strand F 495..503 CDD:409548 3/7 (43%)
Ig strand G 506..516 CDD:409548 5/20 (25%)
IgI_5_Dscam 520..607 CDD:409550 22/87 (25%)
Ig strand A 520..522 CDD:409550 1/1 (100%)
Ig strand A' 527..531 CDD:409550 1/8 (13%)
Ig strand B 534..541 CDD:409550 0/6 (0%)
Ig strand C 548..554 CDD:409550 1/5 (20%)
Ig strand C' 555..557 CDD:409550 0/1 (0%)
Ig strand D 564..568 CDD:409550 1/3 (33%)
Ig strand E 571..577 CDD:409550 4/5 (80%)
Ig strand F 585..593 CDD:409550 4/7 (57%)
Ig strand G 597..607 CDD:409550 1/3 (33%)
Ig 610..703 CDD:472250
Ig strand B 629..633 CDD:409353
Ig strand C 643..647 CDD:409353
Ig strand E 669..673 CDD:409353
Ig strand F 683..688 CDD:409353
Ig strand G 696..699 CDD:409353
IgI_7_Dscam 706..801 CDD:409546
Ig strand A 706..710 CDD:409546
Ig strand A' 715..719 CDD:409546
Ig strand B 722..731 CDD:409546
Ig strand C 737..743 CDD:409546
Ig strand C' 749..752 CDD:409546
Ig strand D 760..763 CDD:409546
Ig strand E 766..772 CDD:409546
Ig strand F 779..787 CDD:409546
Ig strand G 792..801 CDD:409546
Ig 804..889 CDD:472250
Ig strand B 822..826 CDD:409353
Ig strand C 835..839 CDD:409353
FN3 <850..1254 CDD:442628
Ig strand F 882..887 CDD:409353
FN3 906..999 CDD:238020
fn3 1117..1203 CDD:394996
FN3 1185..>1580 CDD:442628
FN3 1405..1494 CDD:238020
zig-2NP_510069.1 Ig 47..134 CDD:472250 29/88 (33%)
Ig strand B 50..54 CDD:409353 1/3 (33%)
Ig strand C 63..67 CDD:409353 0/3 (0%)
Ig strand E 100..104 CDD:409353 2/3 (67%)
Ig strand F 114..119 CDD:409353 2/4 (50%)
Ig strand G 127..130 CDD:409353 1/2 (50%)
Ig <179..232 CDD:472250 16/51 (31%)
Ig strand E 200..204 CDD:409347 2/3 (67%)
Ig strand F 214..219 CDD:409347 2/4 (50%)
Ig strand G 227..230 CDD:409347 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.