DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam4 and ncam-1

DIOPT Version :9

Sequence 1:NP_001261571.1 Gene:Dscam4 / 2769008 FlyBaseID:FBgn0263219 Length:1935 Species:Drosophila melanogaster
Sequence 2:NP_741709.1 Gene:ncam-1 / 180418 WormBaseID:WBGene00017184 Length:955 Species:Caenorhabditis elegans


Alignment Length:884 Identity:197/884 - (22%)
Similarity:325/884 - (36%) Gaps:187/884 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 VNWLHDGKPILRDNRVEIL--TDPPRLIIKKVQKEDPGMYQCFVSNEWEQIQSTAELQLGDASPE 423
            :.|..|||.|.|......:  |...:|:|.:.:..|.|.|.|....:.||.:.:||:...| .|:
 Worm    85 IEWYRDGKLIPRFGSTMTIERTYSNQLMINRPKISDGGKYTCKTEIQGEQQEVSAEISFVD-PPK 148

  Fly   424 LLYWFSEQTLQPGPTVSLKCVATGNPLPQFTWSLDGFPIPDSSRFLVGQYVTIHDDVISHVNISN 488
            .|.....|..:.|....:.|...|....:..|..:|..:.::|:   ..|....::.|.::....
 Worm   149 FLNVQESQHPEEGTRAEIVCEVEGTDQLEVFWQFNGVTLDETSQ---RGYEFSENNQILYIPHFT 210

  Fly   489 VKEEDGGEYTCTAQNAIGKVSHSAKVNIYGLPYIREMPKIT---------GISGSDLIVKCPVAG 544
            .|::| |.|.|.|  |......:..||:.|  |.|  |.||         ||.|..:.:||...|
 Worm   211 AKKDD-GIYNCNA--AQYSSFETLSVNVTG--YAR--PTITVFDVPNGNRGIEGHTIELKCGAVG 268

  Fly   545 YPIDKIHWERDGQTLPINRRQRAYN--NGTLIIEQLQRLEDAGTYTCMAQNKQKQTSRRNVEIQV 607
            .|.....|..:...:||.|..: :|  .|.||||.|.. ||||||.|:| |....::.|..::.|
 Worm   269 KPKPTYKWFFEDDEVPIARSDK-HNVEEGLLIIESLNS-EDAGTYKCVA-NNTVGSNERTFDLAV 330

  Fly   608 LVPPKIMPIQAMTNMLREGMRAAISCQILEGD---LPVSFRWERNGKPLIGTGNEVFRRLDEYSA 669
            .:.||:       ::..|.:       :.|||   |..|:..|.:......:|:..|...:|..:
 Worm   331 FLKPKV-------DLKHEYV-------VKEGDDVELVCSYHGEGHVTAKFVSGHSEFAVRNEAVS 381

  Fly   670 SLVIEHI--SSDHSGNYTCIASNVAGT---ERFTVPLTVNVPPKWILEPKDSSAQAGADVLLHCQ 729
            :...|.|  .|:.|...|..:.|...|   :...:....||.     :.:|.::|         |
 Worm   382 AGNSEEIRPESNESEEVTTTSENSEETSTQDEVELKSAENVN-----DEEDHTSQ---------Q 432

  Fly   730 SSG---YPTPTITWKKAIGPTPGEYKDFLYEPTVQLFPNGTIF-FKKISKESQGHFLCEAKNNIG 790
            ..|   ....:..||:.......:      ..:|:...|..|. .|.||.|....:.|...|:.|
 Worm   433 DDGEQDEQEESKKWKRFADDVNNQ------RISVRAEENKLILTIKSISLEDAADYTCAVSNDAG 491

  Fly   791 SGVSKVIFLKVNVPAHFQTKT-KQISVAKGKQVHVQCNVQGDNPIDFKW-----KIQATQQYLDE 849
            : |:||..:.:..|...:..| ..|....|..|.|.|:|.......:.|     :::|.      
 Worm   492 T-VNKVTQVGIIHPPTLRHYTGPHIRSFDGNTVSVYCDVSAVPSPKWHWFKNGKEVEAN------ 549

  Fly   850 SLDSRYTIRDQVLDDGMVSELGISHTYRQDT-GIYICQASNAFGQDEMSIQLIVQEVPEQPKNLR 913
                  .:..|:...|..::|.:.:....|. |:|.|:|.|..||.|..|.:|....|..|..:.
 Worm   550 ------GVSIQIFTQGSSTKLTLENFDGSDNFGVYTCRADNGVGQLEKQIDVIKVVSPATPSGMN 608

  Fly   914 IN----------SQQSRSLQLTWSQPFAGN---SPIEEYHIYYKQISDIWQNAEHLTIAGAQTVI 965
            ..          |.:|...:...|:|....   :.:||....|.     |.:|:.:::. .:..:
 Worm   609 CKKMVYPNYGKCSFESDIYEKEESKPQTMELLVAKLEEMESDYN-----WSHAQPVSVP-FEDDL 667

  Fly   966 NIQQLRPAKAYHIRMSAENKLGASEFSEVVQVTTLEEVPSGPPLAVRAEPKSSTEIFVTWDAPER 1030
            .|..|.....|.|:..|.|:.|:||:||.:.:.|.:  |..|........|.|....|:||.| .
 Worm   668 TIPNLTSNTQYVIKARAVNEAGSSEYSEEISLETTD--PWAPQAPGSVAMKCSDYCTVSWDTP-N 729

  Fly  1031 DHWNGILLGYYVGYQMSLTPEDKEV----------------------NPTQGFSFKTVEVRSH-- 1071
            ||.:.:|.......:|....:|.||                      |.....|.:::|::.:  
 Worm   730 DHGSPLLKFKVTIQEMKYKTDDDEVEEKSDEKSNNNSEETETTTSDDNDETEASNESIEIKENSE 794

  Fly  1072 ------------------------------FG-----------GETVLANLNKFTQYHVIVQAYT 1095
                                          :|           .:..|.|:.:.:.|.:.|.|..
 Worm   795 EQETTLAHEDSAEILPTDPSTSVERDEMVPYGSLLVLNVDSEENQVQLTNIKQHSYYKISVAAEN 859

  Fly  1096 SQGSGPPSKEIAVQTMEDVPSSPPESPQCDVLGSTSIYI 1134
            .:|.|.|: ||..|| :|.|:...|.     :.||.:.|
 Worm   860 EKGQGEPA-EIDFQT-DDSPTKYEEG-----IDSTHLII 891

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam4NP_001261571.1 Ig 31..124 CDD:416386
Ig strand A 32..35 CDD:409353
Ig strand A' 41..45 CDD:409353
Ig strand B 48..57 CDD:409353
Ig strand D 75..78 CDD:409353
Ig strand E 83..88 CDD:409353
Ig strand F 101..109 CDD:409353
Ig strand G 112..124 CDD:409353
Ig 235..326 CDD:416386
Ig strand A 235..238 CDD:409353
Ig strand A' 244..248 CDD:409353
Ig strand B 251..258 CDD:409353
Ig strand C 266..271 CDD:409353
Ig strand C' 276..279 CDD:409353
Ig strand D 285..289 CDD:409353
Ig strand E 292..298 CDD:409353
Ig strand F 305..313 CDD:409353
Ig strand G 316..326 CDD:409353
IgC2_3_Dscam 329..417 CDD:409549 17/57 (30%)
Ig strand B 347..351 CDD:409549
Ig strand C 360..364 CDD:409549 0/2 (0%)
Ig strand E 383..387 CDD:409549 1/3 (33%)
Ig strand F 397..402 CDD:409549 2/4 (50%)
Ig strand G 410..413 CDD:409549 0/2 (0%)
IgI_4_Dscam 422..516 CDD:409548 19/93 (20%)
Ig strand B 439..443 CDD:409548 0/3 (0%)
Ig strand C 452..456 CDD:409548 0/3 (0%)
Ig strand E 482..486 CDD:409548 0/3 (0%)
Ig strand F 496..501 CDD:409548 2/4 (50%)
Ig strand G 509..512 CDD:409548 0/2 (0%)
IgI_5_Dscam 520..607 CDD:409550 33/97 (34%)
Ig strand B 536..540 CDD:409550 0/3 (0%)
Ig strand C 549..553 CDD:409550 0/3 (0%)
Ig strand E 571..575 CDD:409550 2/3 (67%)
Ig strand F 586..591 CDD:409550 3/4 (75%)
Ig strand G 600..603 CDD:409550 1/2 (50%)
Ig 610..703 CDD:416386 19/100 (19%)
Ig strand A 611..613 CDD:409353 1/1 (100%)
Ig strand A' 620..624 CDD:409353 0/3 (0%)
Ig strand B 627..636 CDD:409353 0/8 (0%)
Ig strand C 641..648 CDD:409353 1/6 (17%)
Ig strand C' 650..652 CDD:409353 0/1 (0%)
Ig strand D 659..664 CDD:409353 1/4 (25%)
Ig strand E 668..675 CDD:409353 0/6 (0%)
Ig strand F 682..690 CDD:409353 1/7 (14%)
Ig strand G 693..702 CDD:409353 1/11 (9%)
IgI_7_Dscam 706..801 CDD:409546 19/98 (19%)
Ig strand B 724..728 CDD:409546 0/3 (0%)
Ig strand C 737..741 CDD:409546 0/3 (0%)
Ig strand E 766..770 CDD:409546 1/4 (25%)
Ig strand F 780..785 CDD:409546 1/4 (25%)
Ig strand G 794..797 CDD:409546 1/2 (50%)
Ig 818..904 CDD:416386 21/91 (23%)
putative Ig strand B 820..827 CDD:409353 2/6 (33%)
putative Ig strand C 835..841 CDD:409353 1/10 (10%)
putative Ig strand C' 853..856 CDD:409353 0/2 (0%)
putative Ig strand D 862..866 CDD:409353 0/3 (0%)
putative Ig strand E 868..874 CDD:409353 1/5 (20%)
putative Ig strand F 881..889 CDD:409353 4/7 (57%)
putative Ig strand G 892..902 CDD:409353 4/9 (44%)
FN3 906..999 CDD:238020 22/105 (21%)
FN3 1006..1110 CDD:238020 28/168 (17%)
fn3 1117..1203 CDD:394996 4/18 (22%)
FN3 1215..1307 CDD:238020
Ig <1334..1401 CDD:416386
Ig strand C 1345..1349 CDD:409353
Ig strand D 1363..1366 CDD:409353
Ig strand E 1367..1372 CDD:409353
Ig strand F 1380..1388 CDD:409353
Ig strand G 1394..1401 CDD:409353
FN3 1405..1494 CDD:238020
FN3 1499..1580 CDD:238020
ncam-1NP_741709.1 IG 64..142 CDD:214652 17/56 (30%)
Ig 69..140 CDD:143165 15/54 (28%)
IG_like 153..236 CDD:214653 18/88 (20%)
Ig 160..222 CDD:299845 13/65 (20%)
IG_like 256..330 CDD:214653 26/76 (34%)
IGc2 256..320 CDD:197706 25/66 (38%)
IG_like <445..499 CDD:214653 15/60 (25%)
Ig <445..498 CDD:143165 15/59 (25%)
IG_like 520..596 CDD:214653 20/87 (23%)
IGc2 520..587 CDD:197706 16/78 (21%)
FN3 <652..701 CDD:238020 13/54 (24%)
FN3 <817..873 CDD:238020 11/56 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10075
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.