DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam4 and Ncam1

DIOPT Version :9

Sequence 1:NP_001261571.1 Gene:Dscam4 / 2769008 FlyBaseID:FBgn0263219 Length:1935 Species:Drosophila melanogaster
Sequence 2:XP_006510118.1 Gene:Ncam1 / 17967 MGIID:97281 Length:1162 Species:Mus musculus


Alignment Length:1167 Identity:248/1167 - (21%)
Similarity:407/1167 - (34%) Gaps:299/1167 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   402 VSNEWEQIQSTAELQL-----------GDASPELLYWFSEQTLQPGPTVSLKCVATGNPLPQFTW 455
            ||.:.:.:.|..|:.:           |||..:.:.|||..    |..:|               
Mouse    18 VSLQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPN----GEKLS--------------- 63

  Fly   456 SLDGFPIPDSSRFLVGQYVTIHDDVISHVNISNVKEEDGGEYTC-------TAQNAIGKVSHSAK 513
                   |:..|.    .|..:||..|.:.|.|...:|.|.|.|       |...|...|....|
Mouse    64 -------PNQQRI----SVVWNDDDSSTLTIYNANIDDAGIYKCVVTAEDGTQSEATVNVKIFQK 117

  Fly   514 VNIYGLPYIREMPKITGISGSDLIVKCPVAGYPIDKIHWERDGQTLPINRRQR--AYNNGTLIIE 576
            :.....|..:|..:     |.|.::.|.|.......|.|:..|:.:.:.:..|  ..:|..|.|.
Mouse   118 LMFKNAPTPQEFKE-----GEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIR 177

  Fly   577 QLQRLEDAGTYTCMAQNKQK-QTSRRNVEIQVLVPPKIMPIQAMTNMLRE-GMRAAISCQILEGD 639
            .::: .|.|||.|..:...: :.:.:::::.|.|||.:...|::.|.... |....:.|. .:|.
Mouse   178 GIKK-TDEGTYRCEGRILARGEINFKDIQVIVNVPPTVQARQSIVNATANLGQSVTLVCD-ADGF 240

  Fly   640 LPVSFRWERNGKPLIGTGNEVFRRL-DEYSASLVIEHISSDHSGNYTCIASNVAGTERFTVPLTV 703
            ...:..|.::|:|:.....:..:.: .:.|:.|.|.::..:....|.|||.|.||.:..::.|.|
Mouse   241 PEPTMSWTKDGEPIENEEEDDEKHIFSDDSSELTIRNVDKNDEAEYVCIAENKAGEQDASIHLKV 305

  Fly   704 NVPPKWILEPKDSSAQAGADVLLHCQSSGYPTPTITWKKAIGPTPGEYKDFLYEPTVQLFPNG-- 766
            ...||.......::.:....|.|.|::||.|.|:|||:.:......|.|.....|..|...:|  
Mouse   306 FAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRPEKQETLDGHM 370

  Fly   767 ---------TIFFKKISKESQGHFLCEAKNNIGSGVSKVIFLKVNVPAHFQTKTKQISVAKGKQV 822
                     ::..|.|.....|.::|.|.|.||.. |:.::|:|......|... .:...:|.||
Mouse   371 VVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQD-SQSMYLEVQYAPKLQGPV-AVYTWEGNQV 433

  Fly   823 HVQCNVQGDNPIDFKWKIQATQQYLDESL--DSRYTIRDQVLDDGMVSELGISHTYRQDTGIYIC 885
            ::.|.|       |.:.......:.|..|  .|.|: ..::.:....|.|.::.....|.|.|.|
Mouse   434 NITCEV-------FAYPSATISWFRDGQLLPSSNYS-NIKIYNTPSASYLEVTPDSENDFGNYNC 490

  Fly   886 QASNAFGQDEMSIQLIVQEVPEQPKNLRINSQQSRSLQLTWSQPFA-GNSPIEEYHIYYKQISD- 948
            .|.|..||:.:...|:..:.|..|...|:....| :.|:.:.:|.| |..||.:|...:|.:.: 
Mouse   491 TAVNRIGQESLEFILVQADTPSSPSIDRVEPYSS-TAQVQFDEPEATGGVPILKYKAEWKSLGEE 554

  Fly   949 ----IWQNAEHLTIAGAQTVINIQQLRPAKAYHIRMSAENKLGASEFSEVVQVTTLEEVPSGPPL 1009
                .|.:|:...:.|   ::.|..|:|...|.:|::|.|..|..|.|...:..| :.|.|.|||
Mouse   555 SWHFKWYDAKEANMEG---IVTIMGLKPETRYSVRLAALNGKGLGEISAATEFKT-QPVHSPPPL 615

  Fly  1010 AVRAEPKSSTEIF------VTWDAP---------------------------------ERDHWNG 1035
            |    |.:|:.:.      .||..|                                 ::|....
Mouse   616 A----PANSSTLVPLSPRATTWPLPVLPTTDLSKGEPSAPKLEGQMGEDGNSIKVNLIKQDDGGS 676

  Fly  1036 ILLGYYVGYQMSLTPEDKEVNPTQGFSFKTVEVRSHFGGETV-LANLNKFTQYHVIVQAYTSQGS 1099
            .:..|.|.|:..|..|.|.            |:|...|.:.| |.:|:...:|.|.|.|...||.
Mouse   677 PIRHYLVKYRAKLASEWKP------------EIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGK 729

  Fly  1100 GPPSKEIAVQTMEDVPSSPPE--SP--------------------------------QCDVLGST 1130
            ...:..:...:.:  |::.|.  ||                                :|.:|...
Mouse   730 SKAAHFVFRTSAQ--PTAIPANGSPTAGLSTGAIVGILIVIFVLLLVVMDITCYFLNKCGLLMCI 792

  Fly  1131 SIYITW-SPPDIDGQNGKIKGYKVFYISVDELYE-----------------------------TD 1165
            ::.:.. :.|...|::.: :|...|  |.||..|                             |:
Mouse   793 AVNLCGKAGPGAKGKDME-EGKAAF--SKDESKEPIVEVRTEEERTPNHDGGKHTEPNETTPLTE 854

  Fly  1166 PEVVKSTNQYVTIEN-LRKYTNYTVWVLAYTKVGDGMKTKPFYCRTHEDVPSAPQAIKAIPASSS 1229
            ||:...|.  .|:|: |...|..|......|:.....:..|....|......||.| ..:|.|:|
Mouse   855 PELPADTT--ATVEDMLPSVTTVTTNSDTITETFATAQNSPTSETTTLTSSIAPPA-TTVPDSNS 916

  Fly  1230 KIIISWLPPDLPNGDIT---GYTFYMSMLEGGREEGTHKRLLGPFVEMHETVRTQESAT------ 1285
                      :|.|..|   |.|...|......:       :.|.|::.:|..:..||:      
Mouse   917 ----------VPAGQATPSKGVTASSSSPASAPK-------VAPLVDLSDTPTSAPSASNLSSTV 964

  Fly  1286 ---YQFWLTASTKMGEGEKTQVVTVPPNNKV-PARIVSFSQRIVTPWKEHLELPCRKVGAPAPVT 1346
               ....|:.||....||.::   .||.:|. ||         .||.......|...|.||    
Mouse   965 LANQGAVLSPSTPASAGETSK---APPASKASPA---------PTPTPAGAASPLAAVAAP---- 1013

  Fly  1347 IWRQDGHNMETSARKTIAKNGTLYMKECQASDAGNYTCSVENTWGKD-EIVYNIVVKVPPEA 1407
                                         |:||........:|.|.| |......||.||||
Mouse  1014 -----------------------------ATDAPQAKQEAPSTKGPDPEPTQPGTVKNPPEA 1046

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam4NP_001261571.1 Ig 31..124 CDD:416386
Ig strand A 32..35 CDD:409353
Ig strand A' 41..45 CDD:409353
Ig strand B 48..57 CDD:409353
Ig strand D 75..78 CDD:409353
Ig strand E 83..88 CDD:409353
Ig strand F 101..109 CDD:409353
Ig strand G 112..124 CDD:409353
Ig 235..326 CDD:416386
Ig strand A 235..238 CDD:409353
Ig strand A' 244..248 CDD:409353
Ig strand B 251..258 CDD:409353
Ig strand C 266..271 CDD:409353
Ig strand C' 276..279 CDD:409353
Ig strand D 285..289 CDD:409353
Ig strand E 292..298 CDD:409353
Ig strand F 305..313 CDD:409353
Ig strand G 316..326 CDD:409353
IgC2_3_Dscam 329..417 CDD:409549 4/14 (29%)
Ig strand B 347..351 CDD:409549
Ig strand C 360..364 CDD:409549
Ig strand E 383..387 CDD:409549
Ig strand F 397..402 CDD:409549 248/1167 (21%)
Ig strand G 410..413 CDD:409549 1/2 (50%)
IgI_4_Dscam 422..516 CDD:409548 21/100 (21%)
Ig strand B 439..443 CDD:409548 1/3 (33%)
Ig strand C 452..456 CDD:409548 0/3 (0%)
Ig strand E 482..486 CDD:409548 1/3 (33%)
Ig strand F 496..501 CDD:409548 2/11 (18%)
Ig strand G 509..512 CDD:409548 0/2 (0%)
IgI_5_Dscam 520..607 CDD:409550 18/89 (20%)
Ig strand B 536..540 CDD:409550 0/3 (0%)
Ig strand C 549..553 CDD:409550 1/3 (33%)
Ig strand E 571..575 CDD:409550 1/3 (33%)
Ig strand F 586..591 CDD:409550 3/4 (75%)
Ig strand G 600..603 CDD:409550 0/2 (0%)
Ig 610..703 CDD:416386 21/94 (22%)
Ig strand A 611..613 CDD:409353 1/1 (100%)
Ig strand A' 620..624 CDD:409353 1/3 (33%)
Ig strand B 627..636 CDD:409353 1/8 (13%)
Ig strand C 641..648 CDD:409353 1/6 (17%)
Ig strand C' 650..652 CDD:409353 1/1 (100%)
Ig strand D 659..664 CDD:409353 0/4 (0%)
Ig strand E 668..675 CDD:409353 3/6 (50%)
Ig strand F 682..690 CDD:409353 4/7 (57%)
Ig strand G 693..702 CDD:409353 1/8 (13%)
IgI_7_Dscam 706..801 CDD:409546 27/105 (26%)
Ig strand B 724..728 CDD:409546 2/3 (67%)
Ig strand C 737..741 CDD:409546 2/3 (67%)
Ig strand E 766..770 CDD:409546 1/14 (7%)
Ig strand F 780..785 CDD:409546 1/4 (25%)
Ig strand G 794..797 CDD:409546 1/2 (50%)
Ig 818..904 CDD:416386 21/87 (24%)
putative Ig strand B 820..827 CDD:409353 2/6 (33%)
putative Ig strand C 835..841 CDD:409353 1/5 (20%)
putative Ig strand C' 853..856 CDD:409353 1/2 (50%)
putative Ig strand D 862..866 CDD:409353 0/3 (0%)
putative Ig strand E 868..874 CDD:409353 2/5 (40%)
putative Ig strand F 881..889 CDD:409353 4/7 (57%)
putative Ig strand G 892..902 CDD:409353 3/9 (33%)
FN3 906..999 CDD:238020 25/98 (26%)
FN3 1006..1110 CDD:238020 28/143 (20%)
fn3 1117..1203 CDD:394996 23/150 (15%)
FN3 1215..1307 CDD:238020 22/103 (21%)
Ig <1334..1401 CDD:416386 11/67 (16%)
Ig strand C 1345..1349 CDD:409353 0/3 (0%)
Ig strand D 1363..1366 CDD:409353 0/2 (0%)
Ig strand E 1367..1372 CDD:409353 0/4 (0%)
Ig strand F 1380..1388 CDD:409353 0/7 (0%)
Ig strand G 1394..1401 CDD:409353 1/6 (17%)
FN3 1405..1494 CDD:238020 3/3 (100%)
FN3 1499..1580 CDD:238020
Ncam1XP_006510118.1 Ig1_NCAM-1 20..115 CDD:143273 25/124 (20%)
IG 124..190 CDD:214652 17/71 (24%)
Ig3_NCAM-1_like 211..308 CDD:143207 22/97 (23%)
Ig_NCAM-1 307..413 CDD:143277 27/106 (25%)
Ig_3 417..494 CDD:372822 18/85 (21%)
FN3 509..606 CDD:238020 25/100 (25%)
fn3 649..731 CDD:365830 19/93 (20%)
PHA03247 <905..1140 CDD:223021 46/205 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.