DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam4 and CNTN1

DIOPT Version :10

Sequence 1:NP_001261571.1 Gene:Dscam4 / 2769008 FlyBaseID:FBgn0263219 Length:1935 Species:Drosophila melanogaster
Sequence 2:NP_001834.2 Gene:CNTN1 / 1272 HGNCID:2171 Length:1018 Species:Homo sapiens


Alignment Length:1143 Identity:278/1143 - (24%)
Similarity:422/1143 - (36%) Gaps:252/1143 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 GRIIVTEPKGMVQPRINVEKHSMRHVVLNGQTTLPCIAQGHPVPTYRWFKEENEQLLPLQLSERI 286
            |.|...:|...:.|..::|          |:.:|.|.|:..|.|.|:|.....:..|   .|:|.
Human    40 GPIFEEQPINTIYPEESLE----------GKVSLNCRARASPFPVYKWRMNNGDVDL---TSDRY 91

  Fly   287 TIVSAGLLKITKARLEDSGKYLCWVNNTAG-----EETIQVSLTVTAPLTAHLQPQVQTVDVDKD 346
            ::|...|:.....:.:|:|.|.|..:|..|     |.|:  |.....|.....:|:|:.    |:
Human    92 SMVGGNLVINNPDKQKDAGIYYCLASNNYGMVRSTEATL--SFGYLDPFPPEERPEVRV----KE 150

  Fly   347 AQFQCIVSGHPVH-----DVNWLHDGKP--ILRDNRVEILTDPPRLIIKKVQKEDPGMYQCFVSN 404
            .:...::...|.|     ...||.:..|  |..|.|..:......|.|..|:..|.|.|.|||| 
Human   151 GKGMVLLCDPPYHFPDDLSYRWLLNEFPVFITMDKRRFVSQTNGNLYIANVEASDKGNYSCFVS- 214

  Fly   405 EWEQIQSTAELQLGDASPEL----------LYWFSEQTLQP----------------GPTVSLKC 443
                            ||.:          |....|:|.:|                |..|:|:|
Human   215 ----------------SPSITKSVFSKFIPLIPIPERTTKPYPADIVVQFKDVYALMGQNVTLEC 263

  Fly   444 VATGNPLPQFTWSLDGFPIPDSSRFLVGQYVTIHDDVISHVNISNVKEEDGGEYTCTAQNAIGKV 508
            .|.|||:|...|.....|:|.::.......|         :.|.|::.||.|.|.|.|:|..||.
Human   264 FALGNPVPDIRWRKVLEPMPSTAEISTSGAV---------LKIFNIQLEDEGIYECEAENIRGKD 319

  Fly   509 SHSAKVNIYGLPYIREMPKITGIS-GSDLIVKCPVAGYPIDKIHWERDGQTLPINRRQRAYNNGT 572
            .|.|::.:...|...|....|.:. ||||...|...|.||..|.|.::|.         ||:.|.
Human   320 KHQARIYVQAFPEWVEHINDTEVDIGSDLYWPCVATGKPIPTIRWLKNGY---------AYHKGE 375

  Fly   573 LIIEQLQRLEDAGTYTCMAQNKQKQTSRRNVEIQVLVPPKIMPIQAMTNMLR-----EGMRAAIS 632
            |.:..: ..|:||.|.|:|:|.. .....|.|:::|.   :.|...|..|.:     :|.|..|.
Human   376 LRLYDV-TFENAGMYQCIAENTY-GAIYANAELKILA---LAPTFEMNPMKKKILAAKGGRVIIE 435

  Fly   633 CQILEGDLPVSFRWERNGKPLIGTGNEVFRRLDEYSASLVIEHISSDHSGNYTCIASNVAGTERF 697
            |:......| .|.|.:..:.|:.:.    |.|.....||.|.:|:.:..|.|||.|.|..|....
Human   436 CKPKAAPKP-KFSWSKGTEWLVNSS----RILIWEDGSLEINNITRNDGGIYTCFAENNRGKANS 495

  Fly   698 TVPLTVNVPPKWILEPKDSSAQAGADVLLHCQSSGYPTPTITWKKAIGPTPGEYKDFLYEPTVQL 762
            |..|.:..|.:.||.|.::....|.:..:.|.:|..|...:|:                   |..
Human   496 TGTLVITDPTRIILAPINADITVGENATMQCAASFDPALDLTF-------------------VWS 541

  Fly   763 FPNGTIFFKKISKESQGHFLCEAKNNIGSGVSKVIFLKVNVPAHFQTKTKQISVAKGKQVHVQCN 827
            | ||.:                           :.|.|.|:  |:|                   
Human   542 F-NGYV---------------------------IDFNKENI--HYQ------------------- 557

  Fly   828 VQGDNPIDFKWKIQATQQYLDESLDSRYTIRDQVLDDGMVSELGISHTYRQDTGIYICQASNAFG 892
                                          |:.:||..  .||.|.:...:..|.|.|.|.....
Human   558 ------------------------------RNFMLDSN--GELLIRNAQLKHAGRYTCTAQTIVD 590

  Fly   893 QDEMSIQLIVQEVPEQPKNLRINSQQSRSLQLTWSQPFAGNSPIEEYHIYYKQI-SDIWQNA--E 954
            ....|..|:|:..|..|..|||...::.|:.||||:....:|||.:|.|..|.| ||.|::|  :
Human   591 NSSASADLVVRGPPGPPGGLRIEDIRATSVALTWSRGSDNHSPISKYTIQTKTILSDDWKDAKTD 655

  Fly   955 HLTIAGAQTVINIQQLRPAKAYHIRMSAENKLGASEFS-EVVQVTTLEEVPSGPPLAVRAEPKSS 1018
            ...|.|.........|.|...|..|:.|.|.||..|.| ...::.|....|:..|..|......:
Human   656 PPIIEGNMEAARAVDLIPWMEYEFRVVATNTLGRGEPSIPSNRIKTDGAAPNVAPSDVGGGGGRN 720

  Fly  1019 TEIFVTWDAPERDHWNGILLGYYVGYQMSLTPEDKEVNPTQGFSFKTVEVRSHFGGETVLAN--L 1081
            .|:.:||....|::..|...||.|.::           |..|..:|.|.|.:...|..|..:  :
Human   721 RELTITWAPLSREYHYGNNFGYIVAFK-----------PFDGEEWKKVTVTNPDTGRYVHKDETM 774

  Fly  1082 NKFTQYHVIVQAYTSQGSGPPSKEIAVQTMEDVPSSPPESPQCDVLGSTSIYITWSPPDIDGQNG 1146
            :..|.:.|.|:|:.::|.||.|....:.:.:|.||..|......||.|:.|.:.|.    .....
Human   775 SPSTAFQVKVKAFNNKGDGPYSLVAVINSAQDAPSEAPTEVGVKVLSSSEISVHWE----HVLEK 835

  Fly  1147 KIKGYKVFYISVDELYETDPEVVKSTNQY-VTIENLRKYTNYTVWVLAYTKVGDGMKTKPFYCRT 1210
            .::.|::.|.:..:..|....|..::.:| ..:|||...|.|.:.|.|....|.|..:......|
Human   836 IVESYQIRYWAAHDKEEAANRVQVTSQEYSARLENLLPDTQYFIEVGACNSAGCGPPSDMIEAFT 900

  Fly  1211 HEDVPSAPQAIKAIPASSSKIIISWLPPD----LPN-GDITGY-TFYMSMLEGGREEGTHKRLLG 1269
            .:..||.|..|.:...|.|:.||:|   |    |.| ..:||| ..|       |.:|.|.   |
Human   901 KKAPPSQPPRIISSVRSGSRYIITW---DHVVALSNESTVTGYKVLY-------RPDGQHD---G 952

  Fly  1270 PFVEMHE---TVRTQESATYQFWLTASTKMGEGEKTQV 1304
            .....|:   .|.......|...:.|.:..|:|..:||
Human   953 KLYSTHKHSIEVPIPRDGEYVVEVRAHSDGGDGVVSQV 990

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam4NP_001261571.1 Ig 31..124 CDD:472250
Ig strand B 50..54 CDD:409353
Ig strand C 63..66 CDD:409353
Ig strand E 82..86 CDD:409353
Ig strand F 102..107 CDD:409353
Ig strand G 115..119 CDD:409353
Ig 235..326 CDD:472250 24/95 (25%)
Ig strand B 253..257 CDD:409353 1/3 (33%)
Ig strand C 266..270 CDD:409353 1/3 (33%)
Ig strand E 292..296 CDD:409353 1/3 (33%)
Ig strand F 306..311 CDD:409353 2/4 (50%)
Ig strand G 319..322 CDD:409353 1/2 (50%)
IgC2_3_Dscam 329..417 CDD:409549 22/94 (23%)
Ig strand A 330..335 CDD:409549 0/4 (0%)
Ig strand A' 338..342 CDD:409549 1/3 (33%)
Ig strand B 345..355 CDD:409549 1/9 (11%)
Ig strand C 360..366 CDD:409549 2/5 (40%)
Ig strand C' 367..370 CDD:409549 1/4 (25%)
Ig strand E 383..389 CDD:409549 2/5 (40%)
Ig strand F 396..404 CDD:409549 5/7 (71%)
Ig strand G 407..417 CDD:409549 0/9 (0%)
IgI_4_Dscam 422..516 CDD:409548 31/119 (26%)
Ig strand A' 430..434 CDD:409548 2/3 (67%)
Ig strand B 437..446 CDD:409548 3/8 (38%)
Ig strand C 451..457 CDD:409548 2/5 (40%)
Ig strand C' 459..462 CDD:409548 0/2 (0%)
Ig strand D 467..475 CDD:409548 0/7 (0%)
Ig strand E 479..488 CDD:409548 1/8 (13%)
Ig strand F 495..503 CDD:409548 4/7 (57%)
Ig strand G 506..516 CDD:409548 4/9 (44%)
IgI_5_Dscam 520..607 CDD:409550 27/87 (31%)
Ig strand A 520..522 CDD:409550 1/1 (100%)
Ig strand A' 527..531 CDD:409550 1/3 (33%)
Ig strand B 534..541 CDD:409550 3/6 (50%)
Ig strand C 548..554 CDD:409550 2/5 (40%)
Ig strand C' 555..557 CDD:409550 0/1 (0%)
Ig strand D 564..568 CDD:409550 0/3 (0%)
Ig strand E 571..577 CDD:409550 2/5 (40%)
Ig strand F 585..593 CDD:409550 4/7 (57%)
Ig strand G 597..607 CDD:409550 2/9 (22%)
Ig 610..703 CDD:472250 26/97 (27%)
Ig strand B 629..633 CDD:409353 1/3 (33%)
Ig strand C 643..647 CDD:409353 1/3 (33%)
Ig strand E 669..673 CDD:409353 2/3 (67%)
Ig strand F 683..688 CDD:409353 3/4 (75%)
Ig strand G 696..699 CDD:409353 0/2 (0%)
IgI_7_Dscam 706..801 CDD:409546 14/94 (15%)
Ig strand A 706..710 CDD:409546 1/3 (33%)
Ig strand A' 715..719 CDD:409546 0/3 (0%)
Ig strand B 722..731 CDD:409546 1/8 (13%)
Ig strand C 737..743 CDD:409546 1/5 (20%)
Ig strand C' 749..752 CDD:409546 0/2 (0%)
Ig strand D 760..763 CDD:409546 1/2 (50%)
Ig strand E 766..772 CDD:409546 1/5 (20%)
Ig strand F 779..787 CDD:409546 0/7 (0%)
Ig strand G 792..801 CDD:409546 1/8 (13%)
Ig 804..889 CDD:472250 12/84 (14%)
Ig strand B 822..826 CDD:409353 0/3 (0%)
Ig strand C 835..839 CDD:409353 0/3 (0%)
FN3 <850..1254 CDD:442628 113/416 (27%)
Ig strand F 882..887 CDD:409353 2/4 (50%)
FN3 906..999 CDD:238020 33/96 (34%)
fn3 1117..1203 CDD:394996 20/86 (23%)
FN3 1185..>1580 CDD:442628 35/129 (27%)
FN3 1405..1494 CDD:238020
CNTN1NP_001834.2 IgI_1_Contactin-1 40..134 CDD:409436 27/108 (25%)
Ig strand A 42..46 CDD:409436 1/3 (33%)
Ig strand A' 49..54 CDD:409436 0/4 (0%)
Ig strand B 60..68 CDD:409436 2/7 (29%)
Ig strand C 73..79 CDD:409436 3/5 (60%)
Ig strand C' 81..84 CDD:409436 0/2 (0%)
Ig strand D 90..94 CDD:409436 1/3 (33%)
Ig strand E 96..102 CDD:409436 1/5 (20%)
Ig strand F 109..118 CDD:409436 3/8 (38%)
Ig strand G 121..134 CDD:409436 4/14 (29%)
Ig2_Contactin-2-like 142..230 CDD:409392 23/108 (21%)
Ig strand A 144..149 CDD:409392 2/8 (25%)
Ig strand B 153..159 CDD:409392 0/5 (0%)
Ig strand C 168..174 CDD:409392 1/5 (20%)
Ig strand C' 179..181 CDD:409392 0/1 (0%)
Ig strand D 186..191 CDD:409392 1/4 (25%)
Ig strand E 194..198 CDD:409392 1/3 (33%)
Ig strand F 208..216 CDD:409392 5/24 (21%)
Ig strand G 218..230 CDD:409392 0/11 (0%)
IgI_3_Contactin-1 241..328 CDD:143259 26/95 (27%)
Ig strand A 241..246 CDD:143259 0/4 (0%)
Ig strand A' 249..254 CDD:143259 0/4 (0%)
Ig strand B 257..266 CDD:143259 3/8 (38%)
Ig strand C 272..276 CDD:143259 0/3 (0%)
Ig strand C' 279..281 CDD:143259 0/1 (0%)
Ig strand D 289..292 CDD:143259 0/2 (0%)
Ig strand E 293..298 CDD:143259 1/13 (8%)
Ig strand F 306..314 CDD:143259 4/7 (57%)
Ig strand G 317..328 CDD:143259 4/10 (40%)
Ig 332..408 CDD:472250 26/86 (30%)
Ig strand B 348..352 CDD:143205 1/3 (33%)
Ig strand C 361..365 CDD:143205 1/3 (33%)
Ig strand E 374..378 CDD:143205 2/3 (67%)
Ig strand F 388..393 CDD:143205 2/4 (50%)
Ig strand G 401..404 CDD:143205 0/2 (0%)
Ig5_Contactin-1 413..501 CDD:409438 26/92 (28%)
Ig strand A 413..418 CDD:409438 1/4 (25%)
Ig strand A' 421..426 CDD:409438 0/4 (0%)
Ig strand B 430..437 CDD:409438 2/6 (33%)
Ig strand C 445..449 CDD:409438 1/3 (33%)
Ig strand D 463..466 CDD:409438 0/2 (0%)
Ig strand E 467..472 CDD:409438 2/4 (50%)
Ig strand F 480..488 CDD:409438 5/7 (71%)
Ig strand G 494..501 CDD:409438 2/6 (33%)
Ig6_Contactin 503..601 CDD:409359 30/197 (15%)
Ig strand A 503..509 CDD:409359 1/5 (20%)
Ig strand A' 512..517 CDD:409359 0/4 (0%)
Ig strand B 520..528 CDD:409359 1/7 (14%)
Ig strand C 537..541 CDD:409359 2/22 (9%)
Ig strand D 562..565 CDD:409359 2/2 (100%)
Ig strand E 566..570 CDD:409359 2/3 (67%)
Ig strand F 579..586 CDD:409359 3/6 (50%)
Ig strand G 593..597 CDD:409359 1/3 (33%)
FN3 610..697 CDD:238020 31/86 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 693..717 5/23 (22%)
FN3 <745..>945 CDD:442628 55/224 (25%)
fn3 811..893 CDD:394996 20/85 (24%)
FN3 905..989 CDD:238020 26/96 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.