DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam4 and ncam1b

DIOPT Version :9

Sequence 1:NP_001261571.1 Gene:Dscam4 / 2769008 FlyBaseID:FBgn0263219 Length:1935 Species:Drosophila melanogaster
Sequence 2:XP_005157462.1 Gene:ncam1b / 114442 ZFINID:ZDB-GENE-010822-2 Length:1055 Species:Danio rerio


Alignment Length:1149 Identity:250/1149 - (21%)
Similarity:404/1149 - (35%) Gaps:329/1149 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   427 WFSE--QTLQPGPTVSLKCVATGNPLPQFTWSLDGFPIPDSSRFLVGQYVTIHDDVISHVNISNV 489
            ||:.  :.::||.                         ||.|       |..:|:..|.:.|.|.
Zfish    52 WFAPAGEKIEPGR-------------------------PDIS-------VIRNDETSSTLTIYNA 84

  Fly   490 KEEDGGEYTCTAQNAIGKVSHSAKVNIY------GLPYIREMPKITGISGSDLIVKCPVAGYPID 548
            |.::.|.|.|.|.:.......:..:.||      .:|..:|..:     |.:.|:.|.|...|..
Zfish    85 KVDNAGTYRCVASSGDQDAEATVNLKIYQKITFTNVPSPQEFTE-----GDNAIIVCDVISSPPP 144

  Fly   549 KIHWERDGQTLPINR--RQRAYNNGTLIIEQLQRLEDAGTYTCMAQNKQK-QTSRRNVEIQVLVP 610
            .:.|:..|..:..::  |.:..:|..|.|..: |..|.|.|||..:.|.: :...|::::.|.|.
Zfish   145 TVLWKYKGAKIQFDKDVRFKTLSNNHLQIRGI-RKTDEGVYTCEGRIKARGEVDFRSIKVVVNVL 208

  Fly   611 PKIMPIQAMTNMLRE-GMRAAISCQILEGDLPVSF-----RWERNGKPLIGTGNEVFRRLDEYSA 669
            |.|...||.||...: |....::|.      |..|     .|.||..|| .:||:.  ..:|..:
Zfish   209 PTIRIRQAETNATADMGFSTLLACD------PDGFPEPIVTWRRNNAPL-ESGNKY--SFNEDGS 264

  Fly   670 SLVIEHISSDHSGNYTCIASNVAGTERFTVPLTVNVPPKWILEPKDSSAQAGADVLLHCQSSGYP 734
            .:.:..::....|:|||||.|.||.....:.|.|.|.||.......::.:....|.|.|:::|.|
Zfish   265 EMTVLDVTKLDEGDYTCIAKNKAGESEQELSLKVFVQPKITYLESQTTTEMDEQVTLTCEATGDP 329

  Fly   735 TPTITWKKAIGP---TPGE-------YKDFLYEPTVQLFPNGTIFFKKISKESQ----------- 778
            ||||||  :.|.   |.||       |:.....|.....|:|.:..:..::.|.           
Zfish   330 TPTITW--SFGTRVFTEGEQEQQKRIYQASWTRPEQHKGPDGEVLVRSDARVSSLTLKYPQYTDA 392

  Fly   779 GHFLCEAKNNIGSGVSKVIFLKVNVPAHFQTKTKQISVA----KGKQVHVQCNVQG-DNPIDFKW 838
            |.:||.|:|.||..|.     .|::...:..|... |||    :|...::.|.|.. .:.:...|
Zfish   393 GQYLCTARNAIGETVQ-----PVSLEVRYAPKILG-SVAVYTWEGNPANISCEVLAHPSDVSITW 451

  Fly   839 KIQATQQYLDESLDSRYTIRDQVLDDGMVSELGISHTYRQDTGIYICQASNAFGQDEMSIQLIVQ 903
            .....|      |.:..|...::.:....|.|.::...:.|.|.|.|..||..|.:.....:|..
Zfish   452 LRDGFQ------LPNANTSNIKIHNTPSASYLEVNPESQSDFGNYNCTTSNEIGTESREFIMIPA 510

  Fly   904 EVPEQPKNLRINSQQ--SRSLQLTWSQP-FAGNSPIEEYHI---------YYKQISDIWQNAEHL 956
            :||..|.   |...|  |.:.|:.:.:| ..|..|:.:|..         :.:::.::......:
Zfish   511 DVPSAPS---IGEVQPYSSTAQVLFEEPESTGGVPVLKYRAEWRAVGRGKWVQRVYEVKDGLSSV 572

  Fly   957 TIAGAQTVINIQQLRPAKAYHIRMSAENKLGASEFSEVVQVTT------------------LEEV 1003
            |:.|         |:|...|.::|||.|..|..:.|..:...|                  .|..
Zfish   573 TVTG---------LKPETDYEVKMSAINGKGEGDSSPSMVFKTEHVRYSYTNGIFHFHTEDTEGE 628

  Fly  1004 PSGPPLAVRAEPKSSTEIFVTWDAPERDHWNGILLGYYVGYQMSLTPEDKEVNPTQGFSFKTVEV 1068
            ||.|.|....:||.:: :.|.|  .::|.....:..|.|.|:   ..||.|..|         |:
Zfish   629 PSPPILEGTLQPKGNS-LKVKW--IKQDDGGSPITHYLVRYK---AREDSEWKP---------EI 678

  Fly  1069 RSHFGGETV-LANLNKFTQYHVIVQAYTSQGSGPP-------SKEIAVQT--MEDVPSSPP---- 1119
            |...|.|.| |..|:..|:|.|.|.|...||...|       |.|....|  |||.|....    
Zfish   679 RLPSGSEYVMLIGLDWDTEYDVFVVAENQQGKSKPGTLTFRTSSEPTATTDSMEDGPGLNTGVIV 743

  Fly  1120 -------------ESPQCDVLGSTSIY--ITWSPPDIDGQNGKIK----GYKVFYISVDELYETD 1165
                         ....|..|....|.  |...|    ||:.|.|    |...|...|.:    :
Zfish   744 GILILVCVLLLLIVDATCCFLNKCGILMCICGKP----GQSTKGKDIETGKAAFVQDVSK----E 800

  Fly  1166 PEVVKSTNQYVTIENLRKYTNYTVWVLAYTKVGDGMKTKPFYCRTHEDVP-SAPQAIKAIPASSS 1229
            |.|...|.:..|       .|:.         .:|      :...:|..| :.|:.:....|:  
Zfish   801 PIVEVRTEEEAT-------ANHD---------AEG------HLEPNETTPLTEPEQVTETAAA-- 841

  Fly  1230 KIIISWLPPDLP-NGDITGYTFYMSMLEGGREEGTHKRLLGPFVEMHETVRTQESATYQFWLTAS 1293
               :..||..:| |.|....||                      ::.::....||.|    ||:|
Zfish   842 ---VVDLPLSVPTNSDTITDTF----------------------DLSQSSPVSESTT----LTSS 877

  Fly  1294 TKMGEGEKTQVVTVPPNNKVPARIVSFSQRIVTPWKEHLELPCRKVGAPAPVTIWRQDGHNMETS 1358
                       :|.||::.:                             .||.:...|....:|.
Zfish   878 -----------ITAPPSDPI-----------------------------NPVHMTPPDSSTPKTH 902

  Fly  1359 ARKTIAKNGTLYMKECQASDAGNYTCSVENTWGKDEIVYNIVVKVPPEAPNL----TVINAYTDS 1419
            :|.:|:           :||..|.|..|:.......:.....|:||....::    |:|:..|::
Zfish   903 SRPSIS-----------SSDPANVTLLVDLAEVSPAVPSEEPVQVPSSPTSVDHPGTIISKVTEN 956

  Fly  1420 LLLEWMDNSHGG----SP---ILGYVINYKRDNGDWEELQVDSK 1456
            ..::  ..||..    ||   |...::|:        ||::|.:
Zfish   957 ESVQ--GPSHAALNPISPQGDIAVPLVNH--------ELEIDGE 990

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam4NP_001261571.1 Ig 31..124 CDD:416386
Ig strand A 32..35 CDD:409353
Ig strand A' 41..45 CDD:409353
Ig strand B 48..57 CDD:409353
Ig strand D 75..78 CDD:409353
Ig strand E 83..88 CDD:409353
Ig strand F 101..109 CDD:409353
Ig strand G 112..124 CDD:409353
Ig 235..326 CDD:416386
Ig strand A 235..238 CDD:409353
Ig strand A' 244..248 CDD:409353
Ig strand B 251..258 CDD:409353
Ig strand C 266..271 CDD:409353
Ig strand C' 276..279 CDD:409353
Ig strand D 285..289 CDD:409353
Ig strand E 292..298 CDD:409353
Ig strand F 305..313 CDD:409353
Ig strand G 316..326 CDD:409353
IgC2_3_Dscam 329..417 CDD:409549
Ig strand B 347..351 CDD:409549
Ig strand C 360..364 CDD:409549
Ig strand E 383..387 CDD:409549
Ig strand F 397..402 CDD:409549
Ig strand G 410..413 CDD:409549
IgI_4_Dscam 422..516 CDD:409548 17/90 (19%)
Ig strand B 439..443 CDD:409548 0/3 (0%)
Ig strand C 452..456 CDD:409548 0/3 (0%)
Ig strand E 482..486 CDD:409548 1/3 (33%)
Ig strand F 496..501 CDD:409548 2/4 (50%)
Ig strand G 509..512 CDD:409548 0/2 (0%)
IgI_5_Dscam 520..607 CDD:409550 21/89 (24%)
Ig strand B 536..540 CDD:409550 1/3 (33%)
Ig strand C 549..553 CDD:409550 0/3 (0%)
Ig strand E 571..575 CDD:409550 1/3 (33%)
Ig strand F 586..591 CDD:409550 3/4 (75%)
Ig strand G 600..603 CDD:409550 1/2 (50%)
Ig 610..703 CDD:416386 28/98 (29%)
Ig strand A 611..613 CDD:409353 1/1 (100%)
Ig strand A' 620..624 CDD:409353 2/3 (67%)
Ig strand B 627..636 CDD:409353 1/8 (13%)
Ig strand C 641..648 CDD:409353 3/11 (27%)
Ig strand C' 650..652 CDD:409353 0/1 (0%)
Ig strand D 659..664 CDD:409353 0/4 (0%)
Ig strand E 668..675 CDD:409353 0/6 (0%)
Ig strand F 682..690 CDD:409353 6/7 (86%)
Ig strand G 693..702 CDD:409353 1/8 (13%)
IgI_7_Dscam 706..801 CDD:409546 30/115 (26%)
Ig strand B 724..728 CDD:409546 2/3 (67%)
Ig strand C 737..741 CDD:409546 3/3 (100%)
Ig strand E 766..770 CDD:409546 1/3 (33%)
Ig strand F 780..785 CDD:409546 2/4 (50%)
Ig strand G 794..797 CDD:409546 0/2 (0%)
Ig 818..904 CDD:416386 17/86 (20%)
putative Ig strand B 820..827 CDD:409353 0/6 (0%)
putative Ig strand C 835..841 CDD:409353 1/5 (20%)
putative Ig strand C' 853..856 CDD:409353 0/2 (0%)
putative Ig strand D 862..866 CDD:409353 0/3 (0%)
putative Ig strand E 868..874 CDD:409353 2/5 (40%)
putative Ig strand F 881..889 CDD:409353 3/7 (43%)
putative Ig strand G 892..902 CDD:409353 1/9 (11%)
FN3 906..999 CDD:238020 21/104 (20%)
FN3 1006..1110 CDD:238020 31/111 (28%)
fn3 1117..1203 CDD:394996 18/108 (17%)
FN3 1215..1307 CDD:238020 16/93 (17%)
Ig <1334..1401 CDD:416386 11/66 (17%)
Ig strand C 1345..1349 CDD:409353 1/3 (33%)
Ig strand D 1363..1366 CDD:409353 1/2 (50%)
Ig strand E 1367..1372 CDD:409353 0/4 (0%)
Ig strand F 1380..1388 CDD:409353 3/7 (43%)
Ig strand G 1394..1401 CDD:409353 0/6 (0%)
FN3 1405..1494 CDD:238020 12/63 (19%)
FN3 1499..1580 CDD:238020
ncam1bXP_005157462.1 Ig 20..112 CDD:299845 17/91 (19%)
I-set 21..111 CDD:254352 17/90 (19%)
IG_like 121..205 CDD:214653 21/89 (24%)
IGc2 128..189 CDD:197706 17/66 (26%)
Ig 208..301 CDD:299845 29/101 (29%)
I-set 212..298 CDD:254352 26/94 (28%)
I-set 298..414 CDD:254352 33/122 (27%)
Ig 300..414 CDD:299845 32/120 (27%)
IG_like 426..505 CDD:214653 16/84 (19%)
Ig 434..505 CDD:143165 15/76 (20%)
FN3 513..606 CDD:238020 21/104 (20%)
FN3 629..720 CDD:238020 31/105 (30%)
Chorion_3 <815..1019 CDD:253174 47/283 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.