Sequence 1: | NP_001261571.1 | Gene: | Dscam4 / 2769008 | FlyBaseID: | FBgn0263219 | Length: | 1935 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038950842.1 | Gene: | Palld / 100360205 | RGDID: | 2322545 | Length: | 1409 | Species: | Rattus norvegicus |
Alignment Length: | 1238 | Identity: | 237/1238 - (19%) |
---|---|---|---|
Similarity: | 354/1238 - (28%) | Gaps: | 535/1238 - (43%) |
- Green bases have known domain annotations that are detailed below.
Fly 43 EFSNNSGGLIECSGHGSPPPEVEW---------TPIPPQQDMVFQLSNGSMMFYPFTAEKYRHEV 98
Fly 99 HATV-----------YRCKLRNLVGT-VLSREVHVRGV-------VNQKYAVQVHDEYVMTGNTA 144
Fly 145 VLKCQVPSYMSEFVLVTAWVQDTGMHLYPNTDIGGKYTVLSNGELYINNAGPNDAYKSYTCR--- 206
Fly 207 -TVNRL----TGEVQ-ISTYPGRIIVTEPKGMVQPRINVEKHSMRHVVLNGQTTLPCIAQGHPVP 265
Fly 266 TYRWFKEENE----------QLLPLQLSERITIVSAGLLKITKARLEDSGKYLCWVNNTAGEETI 320
Fly 321 QVSLTVTA-------------PLTAHLQ------PQVQTVDVD----KDAQFQCI---------- 352
Fly 353 ------------VSG-HPVHDVNWLHDGK------PILRDNRVEILTDPPRLIIKKVQKEDPGMY 398
Fly 399 QCFVSNEWEQIQSTAELQL--------------------------------GDASPELL------ 425
Fly 426 ---------------------------YWFSEQTLQPG-----PTVSLKCVATGNPL-------- 450
Fly 451 ---------PQFTWS----------------LDGFPIPD--------------------SSRFLV 470
Fly 471 GQ--------------------------------------------------------------Y 473
Fly 474 VTIHDDVISH--------------------VNISNVKEEDGGEYTCTAQNA------IG------ 506
Fly 507 ---KVSHSAKVNIYGLPYIREMPKI--TG---------------------------ISGSDLIVK 539
Fly 540 CPVAGYPIDKIHWERDGQTLPINRRQRAYN-----NGTLIIE-QLQRLEDAGTYTCMAQNKQKQT 598
Fly 599 S--------------------------RR-----------NVEIQ-------VLVPPKIMPIQAM 619
Fly 620 TNMLREGMRAAISCQILEGDLPV-SFRWERNGKPLIGTGNEVFRRLDEYSASLVIEHISSDHSGN 683
Fly 684 YTCIASNVAGTERFTVPLTV-----NVPPKWILEPKDSSAQAGADVLLHCQSSGYPTPTITWKKA 743
Fly 744 IGPTPGEYKDFLYEPT--VQLFPNG----TIFFKKISKESQGHFLCEAKNNIGSGVSKVIFLKVN 802
Fly 803 VPAHFQTKTKQISVAKGKQVHVQCN---VQGDNPIDFKWKIQATQQYLDESLDSRYTIRDQVLDD 864
Fly 865 GMV 867 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dscam4 | NP_001261571.1 | Ig | 31..124 | CDD:416386 | 22/101 (22%) |
Ig strand A | 32..35 | CDD:409353 | |||
Ig strand A' | 41..45 | CDD:409353 | 1/1 (100%) | ||
Ig strand B | 48..57 | CDD:409353 | 3/8 (38%) | ||
Ig strand D | 75..78 | CDD:409353 | 0/2 (0%) | ||
Ig strand E | 83..88 | CDD:409353 | 0/4 (0%) | ||
Ig strand F | 101..109 | CDD:409353 | 3/18 (17%) | ||
Ig strand G | 112..124 | CDD:409353 | 4/12 (33%) | ||
Ig | 235..326 | CDD:416386 | 20/100 (20%) | ||
Ig strand A | 235..238 | CDD:409353 | 0/2 (0%) | ||
Ig strand A' | 244..248 | CDD:409353 | 0/3 (0%) | ||
Ig strand B | 251..258 | CDD:409353 | 0/6 (0%) | ||
Ig strand C | 266..271 | CDD:409353 | 1/4 (25%) | ||
Ig strand C' | 276..279 | CDD:409353 | 1/2 (50%) | ||
Ig strand D | 285..289 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 292..298 | CDD:409353 | 2/5 (40%) | ||
Ig strand F | 305..313 | CDD:409353 | 2/7 (29%) | ||
Ig strand G | 316..326 | CDD:409353 | 3/9 (33%) | ||
IgC2_3_Dscam | 329..417 | CDD:409549 | 28/126 (22%) | ||
Ig strand B | 347..351 | CDD:409549 | 0/3 (0%) | ||
Ig strand C | 360..364 | CDD:409549 | 2/3 (67%) | ||
Ig strand E | 383..387 | CDD:409549 | 2/3 (67%) | ||
Ig strand F | 397..402 | CDD:409549 | 1/4 (25%) | ||
Ig strand G | 410..413 | CDD:409549 | 1/2 (50%) | ||
IgI_4_Dscam | 422..516 | CDD:409548 | 33/281 (12%) | ||
Ig strand B | 439..443 | CDD:409548 | 1/3 (33%) | ||
Ig strand C | 452..456 | CDD:409548 | 0/3 (0%) | ||
Ig strand E | 482..486 | CDD:409548 | 0/23 (0%) | ||
Ig strand F | 496..501 | CDD:409548 | 2/4 (50%) | ||
Ig strand G | 509..512 | CDD:409548 | 1/2 (50%) | ||
IgI_5_Dscam | 520..607 | CDD:409550 | 34/165 (21%) | ||
Ig strand B | 536..540 | CDD:409550 | 0/3 (0%) | ||
Ig strand C | 549..553 | CDD:409550 | 2/3 (67%) | ||
Ig strand E | 571..575 | CDD:409550 | 2/3 (67%) | ||
Ig strand F | 586..591 | CDD:409550 | 2/4 (50%) | ||
Ig strand G | 600..603 | CDD:409550 | 2/13 (15%) | ||
Ig | 610..703 | CDD:416386 | 27/93 (29%) | ||
Ig strand A | 611..613 | CDD:409353 | 1/1 (100%) | ||
Ig strand A' | 620..624 | CDD:409353 | 0/3 (0%) | ||
Ig strand B | 627..636 | CDD:409353 | 1/8 (13%) | ||
Ig strand C | 641..648 | CDD:409353 | 2/7 (29%) | ||
Ig strand C' | 650..652 | CDD:409353 | 1/1 (100%) | ||
Ig strand D | 659..664 | CDD:409353 | 0/4 (0%) | ||
Ig strand E | 668..675 | CDD:409353 | 3/6 (50%) | ||
Ig strand F | 682..690 | CDD:409353 | 6/7 (86%) | ||
Ig strand G | 693..702 | CDD:409353 | 2/8 (25%) | ||
IgI_7_Dscam | 706..801 | CDD:409546 | 27/100 (27%) | ||
Ig strand B | 724..728 | CDD:409546 | 2/3 (67%) | ||
Ig strand C | 737..741 | CDD:409546 | 1/3 (33%) | ||
Ig strand E | 766..770 | CDD:409546 | 0/7 (0%) | ||
Ig strand F | 780..785 | CDD:409546 | 0/4 (0%) | ||
Ig strand G | 794..797 | CDD:409546 | 1/2 (50%) | ||
Ig | 818..904 | CDD:416386 | 13/53 (25%) | ||
putative Ig strand B | 820..827 | CDD:409353 | 2/6 (33%) | ||
putative Ig strand C | 835..841 | CDD:409353 | 2/5 (40%) | ||
putative Ig strand C' | 853..856 | CDD:409353 | 1/2 (50%) | ||
putative Ig strand D | 862..866 | CDD:409353 | 1/3 (33%) | ||
putative Ig strand E | 868..874 | CDD:409353 | 237/1238 (19%) | ||
putative Ig strand F | 881..889 | CDD:409353 | |||
putative Ig strand G | 892..902 | CDD:409353 | |||
FN3 | 906..999 | CDD:238020 | |||
FN3 | 1006..1110 | CDD:238020 | |||
fn3 | 1117..1203 | CDD:394996 | |||
FN3 | 1215..1307 | CDD:238020 | |||
Ig | <1334..1401 | CDD:416386 | |||
Ig strand C | 1345..1349 | CDD:409353 | |||
Ig strand D | 1363..1366 | CDD:409353 | |||
Ig strand E | 1367..1372 | CDD:409353 | |||
Ig strand F | 1380..1388 | CDD:409353 | |||
Ig strand G | 1394..1401 | CDD:409353 | |||
FN3 | 1405..1494 | CDD:238020 | |||
FN3 | 1499..1580 | CDD:238020 | |||
Palld | XP_038950842.1 | IgI_2_Titin_Z1z2-like | 278..369 | CDD:409564 | 22/98 (22%) |
Ig strand B | 296..300 | CDD:409564 | 0/3 (0%) | ||
Ig strand C | 309..313 | CDD:409564 | 1/3 (33%) | ||
Ig strand E | 335..339 | CDD:409564 | 1/3 (33%) | ||
Ig strand F | 349..354 | CDD:409564 | 2/4 (50%) | ||
Ig strand G | 362..365 | CDD:409564 | 0/2 (0%) | ||
I-set | 449..546 | CDD:400151 | 26/127 (20%) | ||
Ig strand A' | 454..458 | CDD:409353 | 2/3 (67%) | ||
Ig strand B | 466..474 | CDD:409353 | 3/35 (9%) | ||
Ig strand C | 479..484 | CDD:409353 | 1/4 (25%) | ||
Ig strand C' | 487..489 | CDD:409353 | 0/1 (0%) | ||
Ig strand D | 495..500 | CDD:409353 | 0/4 (0%) | ||
Ig strand E | 511..516 | CDD:409353 | 2/7 (29%) | ||
Ig strand F | 525..533 | CDD:409353 | 2/7 (29%) | ||
Ig strand G | 536..546 | CDD:409353 | 3/9 (33%) | ||
IgI_1_Palladin_C | 1027..1118 | CDD:409474 | 25/92 (27%) | ||
Ig strand B | 1044..1048 | CDD:409474 | 0/3 (0%) | ||
Ig strand C | 1057..1061 | CDD:409474 | 2/3 (67%) | ||
Ig strand E | 1084..1088 | CDD:409474 | 0/3 (0%) | ||
Ig strand F | 1098..1103 | CDD:409474 | 2/4 (50%) | ||
Ig strand G | 1111..1114 | CDD:409474 | 1/2 (50%) | ||
Ig | 1161..1251 | CDD:416386 | 28/98 (29%) | ||
Ig strand A | 1161..1164 | CDD:409353 | 0/2 (0%) | ||
Ig strand A' | 1167..1172 | CDD:409353 | 1/4 (25%) | ||
Ig strand B | 1177..1184 | CDD:409353 | 1/6 (17%) | ||
Ig strand C | 1191..1197 | CDD:409353 | 1/5 (20%) | ||
Ig strand C' | 1198..1201 | CDD:409353 | 2/2 (100%) | ||
Ig strand D | 1207..1213 | CDD:409353 | 0/5 (0%) | ||
Ig strand E | 1216..1226 | CDD:409353 | 4/9 (44%) | ||
Ig strand F | 1230..1238 | CDD:409353 | 6/7 (86%) | ||
Ig strand G | 1240..1251 | CDD:409353 | 4/10 (40%) | ||
IgI_Myotilin_C | 1260..1351 | CDD:409473 | 27/99 (27%) | ||
Ig strand B | 1277..1281 | CDD:409473 | 2/3 (67%) | ||
Ig strand C | 1290..1294 | CDD:409473 | 1/3 (33%) | ||
Ig strand E | 1317..1321 | CDD:409473 | 0/3 (0%) | ||
Ig strand F | 1331..1336 | CDD:409473 | 0/4 (0%) | ||
Ig strand G | 1344..1347 | CDD:409473 | 1/2 (50%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |