DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33234 and Slc22a8

DIOPT Version :9

Sequence 1:NP_001097483.2 Gene:CG33234 / 2769006 FlyBaseID:FBgn0053234 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_112622.1 Gene:Slc22a8 / 83500 RGDID:632286 Length:536 Species:Rattus norvegicus


Alignment Length:387 Identity:83/387 - (21%)
Similarity:157/387 - (40%) Gaps:69/387 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 GELADVYGRRKI-----IMITSTVANIVSILSACVPEFWGFLFL--RSVGGFFIAASVVSLMTYL 132
            |||:|.:||:.|     :|:.::.:.  :..|..:|.:..|.||  .|:.|..::..::::    
  Rat   141 GELSDRFGRKPILTWSYLMLAASGSG--AAFSPSLPVYMIFRFLCGCSISGISLSTVILNV---- 199

  Fly   133 SEFTKISLRPRVLTIMSFSLGVSMIYVPCLAGVLLPLRTEPSSWRILLLCNQVPGIIGIIILVFL 197
             |:...|:|....|.:.:...:....:..||..:       ..||.|.|.:..|..|..::..::
  Rat   200 -EWVPTSMRAISSTSIGYCYTIGQFILSGLAYAI-------PQWRWLQLTSSAPFFIFSLLSWWV 256

  Fly   198 PESPKYYLSINNQEKAMQVMEKICRMN----KGKKVTLNSLGVESLTQPRLRQPTEKHGSCYETK 258
            |||.::.:......||::.::::...|    :|||:|:..|...  .|..:.....|:|.....:
  Rat   257 PESIRWLVLSGKYSKALKTLQRVATFNGKKEEGKKLTIEELKFN--LQKDITSAKVKYGLSDLFR 319

  Fly   259 VLLLNHA----KIMWFFF-IIFFSLSGLG---FALPIWMLRVRVLTATFTDWDTMCSHLDGIKAD 315
            |.:|...    .:.||.. ..::||: :|   |.:.|::|::     .|...|.....:..:...
  Rat   320 VSILRRVTFCLSLAWFSTGFAYYSLA-MGVEEFGVNIYILQI-----IFGGVDIPAKFITILSLS 378

  Fly   316 SPGR--TECHLTYEQMTDPMIHGCVVLALFVVTSVILTWLSRRWVIIGYICIS-IIGCVALNFME 377
            ..||  |:..|.       ::.|..:|||..|.|. :..|.....:.|..|:| ...|:.|...|
  Rat   379 YLGRRITQSFLL-------LLAGGAILALIFVPSE-MQLLRTALAVFGKGCLSGSFSCLFLYTSE 435

  Fly   378 -HPNLILISFFAIIDPLICSVRLAGSMLIDLVPTHLRGKVFALISMTGRAGILITSVYVGYT 438
             :|.::               |..| |.|..|...:...:..|:.:||.....|.:|..|.|
  Rat   436 LYPTVL---------------RQTG-MGISNVWARVGSMIAPLVKITGELQPFIPNVIFGTT 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33234NP_001097483.2 MFS 56..>198 CDD:119392 27/129 (21%)
Slc22a8NP_112622.1 2A0119 11..503 CDD:273328 83/387 (21%)
MFS 124..492 CDD:119392 83/387 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 515..536
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346985
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.