DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33234 and AT4G08878

DIOPT Version :9

Sequence 1:NP_001097483.2 Gene:CG33234 / 2769006 FlyBaseID:FBgn0053234 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_680668.1 Gene:AT4G08878 / 826464 AraportID:AT4G08878 Length:280 Species:Arabidopsis thaliana


Alignment Length:210 Identity:48/210 - (22%)
Similarity:87/210 - (41%) Gaps:38/210 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 IAGASCEMRIHDRRLAWLMAASFAAQMVSCFLWGELADVYGRRKIIMITSTVANIVSILSA---- 102
            :.|:|....:.|.....:...:||...:....:|.|.|..||:::..:|..:..|.||.|:    
plant    38 VPGSSSPGSLPDGISVAVSGVAFAGTFLGQIFFGCLGDKLGRKRVYGLTLLIMTICSIASSLSFG 102

  Fly   103 ----------CVPEFW-GFLFLRSVGGFFIAASVVSLMTYLSEFTKISLRPRVLTIMSFSL---- 152
                      |...|| ||    .:||.:..::.: :..|.::.|:.:....|..:....:    
plant   103 KDPKTVMVTLCFFRFWLGF----GIGGDYPLSATI-MFEYANKRTRGAFIASVFAMQGVGILAAG 162

  Fly   153 GVSMIYVPCLAGVLLPLR---------TEPSS---WRILLLCNQVPGIIGIIILVFLPESPKY-Y 204
            |||:: |..|..:..|.|         |.|.:   |||:|:...:|.::.....:.:||:.:| .
plant   163 GVSLL-VSYLFEIEFPSRAYILDGAASTVPQADYVWRIILMVGALPALLTYYWRMKMPETARYTA 226

  Fly   205 LSINNQEKAMQVMEK 219
            |...|.|:|...|.|
plant   227 LVAKNAEQAALDMNK 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33234NP_001097483.2 MFS 56..>198 CDD:119392 36/172 (21%)
AT4G08878NP_680668.1 MFS 13..>172 CDD:119392 29/139 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D724235at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.