DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33234 and svopb

DIOPT Version :9

Sequence 1:NP_001097483.2 Gene:CG33234 / 2769006 FlyBaseID:FBgn0053234 Length:475 Species:Drosophila melanogaster
Sequence 2:XP_021327288.1 Gene:svopb / 555216 ZFINID:ZDB-GENE-070705-359 Length:266 Species:Danio rerio


Alignment Length:219 Identity:49/219 - (22%)
Similarity:81/219 - (36%) Gaps:40/219 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 MWFFFIIFFSLSGLGFALPIWMLRVRVLTATFTDWDTMCSHLDGIKADSPGRTEC-----HLTYE 327
            :|||....:    .|..|         ||.......:.|    |:..:|....:|     |||.:
Zfish    41 IWFFSAFLY----YGLVL---------LTTELFQAGSAC----GVTENSNIEHQCSLMCQHLTID 88

  Fly   328 QMTDPM------IHGCVVLALFVVTSVILTWLSRRWVIIGYICISIIGCVALNFMEHPNLILISF 386
            ...|.:      ..|.:| ||::|..:     |||..::  ||.|:.....|......:.|:::.
Zfish    89 DYLDLLWTTFAEFPGLLV-ALWMVNRI-----SRRKSMV--ICFSLFTVCILPLYACTHRIVLTV 145

  Fly   387 FAII--DPLICSVRLAGSMLIDLVPTHLRGKVFALISMTGRAGILITSVYVGYTLSYICYVTFNI 449
            |..|  ..:....::|.....::.||..|.......|...|.|.|:|.......|....|:|.::
Zfish   146 FIFIARTSINAGWQIAYVYTPEVFPTATRAIGIGTSSGMSRVGALVTPFIAQVLLKSSVYLTLSV 210

  Fly   450 FILVLIVTGCHVYW-LPSEFQRTS 472
            : |:..:.|....| ||.|.:..|
Zfish   211 Y-LIFGLLGTAACWALPMETEGRS 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33234NP_001097483.2 MFS 56..>198 CDD:119392
svopbXP_021327288.1 Sugar_tr <23..236 CDD:331684 49/219 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.