DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33234 and CG4462

DIOPT Version :9

Sequence 1:NP_001097483.2 Gene:CG33234 / 2769006 FlyBaseID:FBgn0053234 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_650849.1 Gene:CG4462 / 42376 FlyBaseID:FBgn0038752 Length:573 Species:Drosophila melanogaster


Alignment Length:323 Identity:63/323 - (19%)
Similarity:110/323 - (34%) Gaps:121/323 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 FSLGVSMIYVPCLAGVLLP-LRTEPSSWRILLLCNQVPGIIGIIILVFLPESPKYYL-------S 206
            :|:||          :||| |.:..:||.::.:....|.|:.|::|.:.|:||::.|       |
  Fly   245 WSIGV----------ILLPGLSSFFNSWSLIYVGITFPTIMLILLLYWTPDSPRWLLRHAADRFS 299

  Fly   207 INNQEKAM----------------------QVMEKI---------CRMNKGKK------------ 228
            |:|.|:.:                      |:.|::         ..:.|||:            
  Fly   300 IDNVEQILREGAAINDRSFKIPPDFRQQLEQLSERLKAQPPPAPWTELWKGKRAKTHMVAAHLAL 364

  Fly   229 -----------VTLNSLGVESLTQPRLRQPTEKHGSCYETKVLLLNHAKIMWFFFIIFFSLSGLG 282
                       :.:.|.|.:.|....:.....:...|:......|.|.|..|....:|..|:|: 
  Fly   365 AFFVINFMGMLLNIRSFGRDYLVPNTIAMGFSEIIGCFLALHFTLKHNKWKWQCAGVFNILAGI- 428

  Fly   283 FALPIWMLRVRVLTATFTDWDTMCSHLD----GIKADSP-GRTECHLTYEQMTDPMIHGCV---- 338
            .....|:         ||:.|:|.:.|.    .|.|..| ....|       ...||..|:    
  Fly   429 LGCMGWI---------FTNADSMDADLKVSLWMIIATIPKAAVSC-------AQSMILACMNELM 477

  Fly   339 ---VLALFVVTSVILTWLSRRWV-----------------IIGYICISIIGCVALNFMEHPNL 381
               ...|||.:  ::|| :|.|:                 :..|...||:|.:..:.:..|.|
  Fly   478 PANKKQLFVFS--VVTW-ARVWLLSAPFFNVLRKIDTAMSLTSYCVFSILGGICTSLLLTPRL 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33234NP_001097483.2 MFS 56..>198 CDD:119392 13/48 (27%)
CG4462NP_650849.1 2A0119 <126..532 CDD:273328 61/316 (19%)
MFS 149..>284 CDD:119392 13/48 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458152
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.