DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33234 and CG8925

DIOPT Version :9

Sequence 1:NP_001097483.2 Gene:CG33234 / 2769006 FlyBaseID:FBgn0053234 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_650526.1 Gene:CG8925 / 41963 FlyBaseID:FBgn0038404 Length:670 Species:Drosophila melanogaster


Alignment Length:406 Identity:93/406 - (22%)
Similarity:164/406 - (40%) Gaps:118/406 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 SCFLWGE---------LADVYGRRKIIMITSTVANIVSILSACVPEFWGFLFLRSVGGFFIAASV 125
            :|||.|.         ::|.:|||..:|...|:.::...:.|.......|:.||.:.||  |:..
  Fly   282 TCFLVGAAAGAVLSGWISDRFGRRHTLMAFVTIQSVFGGILAFSTSVAMFMSLRVIIGF--ASMT 344

  Fly   126 VSLMTYLSEFTKISLRPR-VLTIMSFSLGVSMIYVPCLAGVLLPLRTEPSSWRILLLCNQVPGII 189
            |::::::.....:|.:.| |:.|::. |.|::.|| ..||:...:|    .||.|.|....|.:|
  Fly   345 VTVVSFVLVVELVSGKWRTVIGILNI-LPVAISYV-LSAGLAYLIR----DWRHLQLAISWPWLI 403

  Fly   190 GIIILVFLPESPKYYLSINNQEKAMQVMEKICRMNKGKKVTLNSLGVESL--TQPRLRQPTEKHG 252
            .:.|..:|||||::.|:....::...::|:..||| |...:|.|...::|  ..||..|...:..
  Fly   404 MLSIWFWLPESPRWLLAQGRLDELCGLIERAARMN-GTSASLPSNYRKTLEAAVPRAVQSPPEAT 467

  Fly   253 SCYETK-----------------VLLLNHAK---------IMWFFFIIFFSLSGLGFALPIWMLR 291
            :..|:|                 :|::..||         ::|...||.:      |.|.:.:  
  Fly   468 TSVESKAVEADAPDPSASGHVNPLLVVFSAKYWRTTCLTLVIWLTLIIIY------FGLTLHL-- 524

  Fly   292 VRVLTATFTDWDTMCSHLDG---IKADSPGRTECHLTYEQMTDPMIHGCVVLALFVVTSVILTWL 353
                           |:|.|   |.:...|..|.           |..|:  ::.||..|.:   
  Fly   525 ---------------SNLGGNIYINSAVAGTVEA-----------ISICI--SILVVLKVGI--- 558

  Fly   354 SRRWVIIGYICISIIGCVALNFMEHP-----------------NLILISFFAIIDPLICSVR--- 398
              |..:|||:.:..:.|:|.|.:.:.                 |.|:.::.|:..|.|  ||   
  Fly   559 --RRSLIGYMLLPGLCCLATNLVSNQTGVIALATIAKCLIGANNAIIPTYTAMQYPTI--VRNFG 619

  Fly   399 -----LAGSMLIDLVP 409
                 ||..:.:.|||
  Fly   620 VGMGNLASGIALILVP 635

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33234NP_001097483.2 MFS 56..>198 CDD:119392 36/137 (26%)
CG8925NP_650526.1 MFS 277..667 CDD:119392 93/406 (23%)
MFS_1 277..635 CDD:284993 91/404 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.