DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33234 and CG5592

DIOPT Version :9

Sequence 1:NP_001097483.2 Gene:CG33234 / 2769006 FlyBaseID:FBgn0053234 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_647996.1 Gene:CG5592 / 38662 FlyBaseID:FBgn0035645 Length:540 Species:Drosophila melanogaster


Alignment Length:422 Identity:89/422 - (21%)
Similarity:174/422 - (41%) Gaps:79/422 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 FAAQMVSCFLWGELADVYGRRKIIMITSTVANIVSILSACV----PEFWGFLFLRSVGGFFIAAS 124
            |...:|.|..:|.:.|..||...:.:    ||..|::..||    .:|..|...|.|.|..:...
  Fly   147 FVGCIVGCLCFGFITDHSGRLPALFL----ANSCSMIGGCVSVVCKDFPCFAASRFVAGLSMNYC 207

  Fly   125 VVSLMTYLSEFTKISLRPRVLT-----IMSFSLGVSMIYVPCLAGVLLPLRTEPSSWRILLLCNQ 184
            .|.:  |:.....:.::.|.|.     ...|:||..::  |.||.|:       |:||...:...
  Fly   208 FVPI--YILTLENVGIKYRTLVGNLALTFFFTLGACLL--PWLAYVI-------SNWRHYAMVVA 261

  Fly   185 VPGIIGIIILVFLPESPKYYLSINNQEKAMQVMEKICRMNKGKKVTLNSLGVESLTQPRLRQPTE 249
            :|.:..|:..:..||||.:.:|:...::.::||::..:.| ||.::     .|..::.|      
  Fly   262 LPIVFMILTSLLAPESPSWLMSVGKVDRCIEVMKEAAKAN-GKIIS-----EEVWSEMR------ 314

  Fly   250 KHGSCYETKVLLLNHAKIMWFFFIIFFSLSGLG---FALPIWML--RVRVLTATFTDWDTMCSHL 309
               .|||.|                 |:...||   .:|.::..  |:.|||.....|.|:....
  Fly   315 ---ECYELK-----------------FANEQLGKQYTSLDLFKTFPRLVVLTILIVTWMTVALAY 359

  Fly   310 DG-IKADSPGRTECHLTYEQMTDPMIHGCVVLALFVVTSVILTWLSRRWVI--IGYICIS---II 368
            |. ::......|:..:|:.      :...|.:...:|..::|..:.|:.::  :..:|.:   .:
  Fly   360 DAHVRVVEILDTDIFITFS------LSSLVEIPAGIVPMLLLDRIGRKPMMSAVMLLCAASSLFV 418

  Fly   369 GCVALNFMEHPNLILISFFAIIDPLICSVRLAGSMLIDLVPTHLRGKVFALISMTGRAGILITSV 433
            |.:..::......|...|||.:     :..:......:::||.|||:..|:|::.|:.|.|::.:
  Fly   419 GILKGHWNASTAAIAARFFATM-----AYNVGQQWASEILPTVLRGQGLAIINIMGQMGALLSPL 478

  Fly   434 YVGYTLSYICYVTFNIFILVLIVTGCHVYWLP 465
            .:. |..|...:...|..||.::....:.:||
  Fly   479 VLS-THRYYRPLPMFIITLVSVIGALIILFLP 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33234NP_001097483.2 MFS 56..>198 CDD:119392 33/142 (23%)
CG5592NP_647996.1 2A0119 17..519 CDD:273328 89/422 (21%)
MFS 141..509 CDD:119392 87/420 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458245
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.