DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33233 and SLC22A14

DIOPT Version :9

Sequence 1:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster
Sequence 2:XP_006713479.2 Gene:SLC22A14 / 9389 HGNCID:8495 Length:675 Species:Homo sapiens


Alignment Length:531 Identity:102/531 - (19%)
Similarity:180/531 - (33%) Gaps:175/531 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LTIGYGLGQVIIFMVS-------FFIYMYSVTESMTAGYLVVLTSCEFDTSPKEKTLLANSLLGG 68
            |.:.:.|..:|.|.::       .:||..:...|:...:.:|   |..:|......::   .:.|
Human   216 LPVPWNLDSIIQFGLNDTDTCQDGWIYPDAKKRSLINEFDLV---CGMETKKDTAQIM---FMAG 274

  Fly    69 MVASGLFIGFLADRYGRKFVIRLALVGALSFSVISALMPD-----LYSLSVIRIIVGTFLSAVAS 128
            :....|....:.|:.||...|.|:|:|.:.|...:|.|..     .:...:.:.:||..:|:::.
Human   275 LPIGSLIFRLITDKMGRYPAILLSLLGLIIFGFGTAFMNSFHLYLFFRFGISQSVVGYAISSISL 339

  Fly   129 LQVGFLGEFHAIKWRPITVAICSQSQGLALIYCPLVAMAILPNNFNVDLSSSYNLRVWRFLMMFF 193
            .....:||..|              ..:.|.:|.....|:|....      :|:|..|:.|   |
Human   340 ATEWLVGEHRA--------------HAIILGHCFFAVGAVLLTGI------AYSLPHWQLL---F 381

  Fly   194 MIPGWLALVGIC---LVPETPHFLMSVNRPDKALLALKWICRMNRKKWEDVDITLSEE------- 248
            ::.|.|.:..|.   ::||:|.:||...:..:|...|.:...:|:|   .:...|.:|       
Human   382 LVGGILVIPFISYIWILPESPRWLMMKGKVKEAKQVLCYAASVNKK---TIPSNLLDELQLPRKK 443

  Fly   249 --KSSTND-------------QEGFWKTVWYEYKLLFSK--------------PHVFKF---FIC 281
              ::|..|             ....|.||.|.|..|..:              |.:.:.   ..|
Human   444 VTRASVLDFCKNRQLCKVTLVMSCVWFTVSYTYFTLSLRMRELGVSVHFRHVVPSIMEVPARLCC 508

  Fly   282 LFLI------FGIFFTSIGLGIWFPVIRNMDNSGSNRLCDLVNNNPTFINHEADDTNGTDSESPK 340
            :||:      :.:..|.:...||               |.|:...|     |.:|  |...:.|:
Human   509 IFLLQQIGRKWSLAVTLLQAIIW---------------CLLLLFLP-----EGED--GLRLKWPR 551

  Fly   341 CNDEMTNLIDPVYYGFTYIGCFILASVLVHWMTRKYVIALHILISMILGISLNIMKQPTVVLIFF 405
            |  ..|.|                             .::.||:.|:...||     ...|.:||
Human   552 C--PATEL-----------------------------KSMTILVLMLREFSL-----AATVTVFF 580

  Fly   406 VLMMVLPGVLIPLATSVLVDCLPVNLRGKALCMVRSLARFGGVLGSTMIGLFIRVTCDVTFNIFN 470
                        |.|:.|   ||..||...|.:|...:..|.:|..|:|.....:          
Human   581 ------------LYTAEL---LPTVLRATGLGLVSLASVAGAILSLTIISQTPSL---------- 620

  Fly   471 LCLAICVVLAV 481
            |.:.:|.|||:
Human   621 LPIFLCCVLAI 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 92/488 (19%)
MFS 23..>208 CDD:119392 37/199 (19%)
MFS 354..>482 CDD:304372 26/128 (20%)
SLC22A14XP_006713479.2 2A0119 141..650 CDD:273328 102/531 (19%)
MFS 270..641 CDD:119392 92/474 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153423
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.