DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33233 and SLC22A6

DIOPT Version :9

Sequence 1:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_004781.2 Gene:SLC22A6 / 9356 HGNCID:10970 Length:563 Species:Homo sapiens


Alignment Length:287 Identity:65/287 - (22%)
Similarity:112/287 - (39%) Gaps:47/287 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 TESMTAGYL--------VVLTSCEFDTSPKEKTLLANSL-LGGMVASGLFIGFLADRYGRKFVIR 90
            ||..|.|::        .::|..:...|.:....||.|| :.|::...:..|:||||.||:.|:.
Human   102 TEPCTDGWIYDNSTFPSTIVTEWDLVCSHRALRQLAQSLYMVGVLLGAMVFGYLADRLGRRKVLI 166

  Fly    91 LALVGALSFSVISALMPDLYSLSVIRIIVGTFLSAVASLQVGFLGEFHAIKWRPITVAICSQSQG 155
            |..:........:|..|:.......|::.|..|:.: ||....|.    ::|.||....|   .|
Human   167 LNYLQTAVSGTCAAFAPNFPIYCAFRLLSGMALAGI-SLNCMTLN----VEWMPIHTRAC---VG 223

  Fly   156 LALIYCPLVAMAILPNNFNVDLSSSYNLRVWRFLMMF-------FMIPGWLALVGICLVPETPHF 213
            ..:.|...:...:|       ...:|.:..||.|.:.       |.|..|..:       |:..:
Human   224 TLIGYVYSLGQFLL-------AGVAYAVPHWRHLQLLVSAPFFAFFIYSWFFI-------ESARW 274

  Fly   214 LMSVNRPDKALLALKWICRMNRKKWEDVDITLSEEKSSTNDQEGFWKTVWYEYKLLFSKPHVFKF 278
            ..|..|.|..|.||:.:.|:|.|:.|...:::...::|...:....|......:|| ..|.:...
Human   275 HSSSGRLDLTLRALQRVARINGKREEGAKLSMEVLRASLQKELTMGKGQASAMELL-RCPTLRHL 338

  Fly   279 FICL--------FLIFGIFFTSIGLGI 297
            |:||        |..:|:.....|.|:
Human   339 FLCLSMLWFATSFAYYGLVMDLQGFGV 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 65/287 (23%)
MFS 23..>208 CDD:119392 42/188 (22%)
MFS 354..>482 CDD:304372
SLC22A6NP_004781.2 2A0119 11..515 CDD:273328 65/287 (23%)
MFS 135..505 CDD:119392 59/254 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 525..563
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153405
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.