DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33233 and Slc22a8

DIOPT Version :9

Sequence 1:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_112622.1 Gene:Slc22a8 / 83500 RGDID:632286 Length:536 Species:Rattus norvegicus


Alignment Length:287 Identity:71/287 - (24%)
Similarity:121/287 - (42%) Gaps:54/287 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 TESMTAGYLVVLTS----CEFD---TSPKEKTLLANSLLGGMVASGLFIGFLADRYGRKFVIRLA 92
            ||....|::...|.    .|:|   :|.|.|.:..:..:.|::..|..||.|:||:|||.::..:
  Rat    92 TEPCLDGWIYNSTRDTIVIEWDLVCSSNKLKEMAQSIFMAGILVGGPVIGELSDRFGRKPILTWS 156

  Fly    93 LVGALSFSVISALMPDLYSLSVIRIIVGTFLSAVASLQVGFLGEFHAIKWRPITV-AICSQSQGL 156
            .:...:....:|..|.|....:.|.:.|..:|.: ||....|.    ::|.|.:: ||.|.|.| 
  Rat   157 YLMLAASGSGAAFSPSLPVYMIFRFLCGCSISGI-SLSTVILN----VEWVPTSMRAISSTSIG- 215

  Fly   157 ALIYCPLVAMAILPNNFNVDLSSSYNLRVWRFLMM--------FFMIPGWLALVGICLVPETPHF 213
               ||..:...||.       ..:|.:..||:|.:        |.::..|        |||:..:
  Rat   216 ---YCYTIGQFILS-------GLAYAIPQWRWLQLTSSAPFFIFSLLSWW--------VPESIRW 262

  Fly   214 LMSVNRPDKALLALKWICRMNRKKWEDVDITLSE-----EKSSTNDQEGFWKTVWYEYKLLFSKP 273
            |:...:..|||..|:.:...|.||.|...:|:.|     :|..|:.:      |.|....||...
  Rat   263 LVLSGKYSKALKTLQRVATFNGKKEEGKKLTIEELKFNLQKDITSAK------VKYGLSDLFRVS 321

  Fly   274 HVFKFFICLFLIF---GIFFTSIGLGI 297
            .:.:...||.|.:   |..:.|:.:|:
  Rat   322 ILRRVTFCLSLAWFSTGFAYYSLAMGV 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 71/287 (25%)
MFS 23..>208 CDD:119392 45/188 (24%)
MFS 354..>482 CDD:304372
Slc22a8NP_112622.1 2A0119 11..503 CDD:273328 71/287 (25%)
MFS 124..492 CDD:119392 62/255 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 515..536
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346984
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.