DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33233 and Slc22a23

DIOPT Version :9

Sequence 1:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_001028339.1 Gene:Slc22a23 / 73102 MGIID:1920352 Length:689 Species:Mus musculus


Alignment Length:460 Identity:93/460 - (20%)
Similarity:177/460 - (38%) Gaps:104/460 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 SLLGGMVASGLFIGFLADRYGRKFVIRLALVGALSFSVISALMPDLYSLSVIRIIVGTFLSAVAS 128
            |||.|::...|..|.:||..||:.|:..:.:..|.|.:..||..::...|.:|...|..|:    
Mouse   230 SLLVGLIFGYLITGCIADWVGRRPVLLFSTIFILIFGLTVALSVNVTMFSTLRFFEGFCLA---- 290

  Fly   129 LQVGFLGEFHAIKWRPITVAICSQSQGLAL-IYCPLVAMA---ILPNNFNVDLSSSYNLRVWRFL 189
               |.:...:|::     :.:|...:...: :....||||   ::|.     |::.  .|.|:.|
Mouse   291 ---GIILTLYALR-----IELCPPGKRFIITMVASFVAMAGQFLMPG-----LAAL--CRDWQVL 340

  Fly   190 MMFFMIPGWLALVGICLVPETPHFLMSVNRPDKALLALKWICRMNRKKWEDVDITLSEEKSSTND 254
            ....:.|..|.|:...:.||:..:||:..:.:.|...:.::.:.|         .:|.|    :|
Mouse   341 QALIICPFLLMLLYWSIFPESLRWLMATQQFESAKKLILYLTQKN---------CVSPE----SD 392

  Fly   255 QEGFWKTVWYEYKLLFSKPHVFKFFICLFLIFGIFFTSIGLGIWFPVIRNMDNSGSNRLCDLVNN 319
            .:|....:   .|.|..:|..    :|:..:.|.      ..:|..::         .||  ||:
Mouse   393 IKGVMPEL---EKELSRRPKK----VCIVKVVGT------RNLWKNIV---------VLC--VNS 433

  Fly   320 NPTFINHE--ADDTNGTDSESPKCNDEMTNLIDPVYYGFTYIGCFILASVLVHWMTRKYV----- 377
            ...:..|.  |....|.:.:.|        |::..|..:..:....|||.|...:..|::     
Mouse   434 LTGYGIHHCFARSMMGHEVKVP--------LLENFYADYYTMASIALASCLAMCLVVKFLGRRGG 490

  Fly   378 ----IALHILISMI-LGISLNIM----KQPTVVL------------------IFFVLMMVLPGVL 415
                :.|..|.|:: ||: ||::    :.|...|                  .|.::.|.....:
Mouse   491 LLLFMILTALASLLQLGL-LNLIGKYSQHPDSELQLKLAVGMSDSVKDKFSIAFSIVGMFASHAV 554

  Fly   416 IPLATSVLVDCLPVNLRGKALCMVRSLARFGGVLGSTMIGLFIRVTCDVTFNIFNLCLAICVVLA 480
            ..|:.....:..|..:|...|.:|.:.|.| |:|.:.:|.|..:....:...||..|..||::..
Mouse   555 GSLSVFFCAEITPTVIRCGGLGLVLASAGF-GMLTAPIIELHNQKGYFLHHIIFACCTLICIICI 618

  Fly   481 VFQPK 485
            :..|:
Mouse   619 LLLPE 623

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 85/424 (20%)
MFS 23..>208 CDD:119392 34/147 (23%)
MFS 354..>482 CDD:304372 32/159 (20%)
Slc22a23NP_001028339.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55
2A0119 98..631 CDD:273328 93/460 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..188
MFS 230..>359 CDD:119392 34/147 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843334
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.