DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33233 and Slc22a16

DIOPT Version :9

Sequence 1:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_081848.1 Gene:Slc22a16 / 70840 MGIID:1918090 Length:649 Species:Mus musculus


Alignment Length:406 Identity:82/406 - (20%)
Similarity:145/406 - (35%) Gaps:129/406 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 LLGGMVASGLFIGFLADRYGRKFVIRLALVGALSFSVISALMPDLYSLSVIRIIV-----GTFLS 124
            ::.|::...:...:|:||:||:..:....:|...|.:.|..:.|..|..:.|..:     |.|: 
Mouse   161 IIFGVMLGSITFSYLSDRFGRRMALWCTSIGVFFFGIASLFIFDYLSFMITRFFLVMASSGYFV- 224

  Fly   125 AVASLQVGFLGEFHAIKWRPITVAICSQSQGLALIYCPLVAMAILPNNFNVDLSSSYNLRVWRFL 189
            .|....:..:|: .|..|..|.:      .....|...|||:|            ||.|:.|   
Mouse   225 VVFVYVMEIIGK-KARTWASIHL------NTFFAIGAMLVALA------------SYLLKTW--- 267

  Fly   190 MMFFMIPGWLALVGICLV-----------PETPHFLMSVNRPDKALLALKWICRMNRKKWED--- 240
                    ||..:.:|:|           ||||.:|:|..|..:|...:..:...|:....|   
Mouse   268 --------WLYQIILCIVTTPFILCCWMLPETPFWLLSEGRYKEAQGTVDTMAVWNKSSSCDLVE 324

  Fly   241 ---VDITLSEEKSSTNDQEGFWKTVWYEYKL--LFSKPHVFKFFICLFLIFGIFFTSIGLGIWF- 299
               :|:|.|..||..:.:         :::|  ||....|.|..:.::|   .:||: .||.:. 
Mouse   325 LLSLDVTRSHNKSPHSIR---------KHRLADLFHNLDVAKMTLIVWL---DWFTA-NLGYYMF 376

  Fly   300 --PVIRNMDNSGSNRLCDLVNNNPTFINHEADDTNGTDSESPKCNDEMTNLIDPVY---YGFTYI 359
              .|||..:|                                          :|:|   .|...|
Mouse   377 GKEVIRRKEN------------------------------------------EPLYLLLVGAMEI 399

  Fly   360 GCFILASVLVHWMTRKYVIALHILIS-------MILGISLNIMKQPTVVLIFFVLMMVLPGVLIP 417
            ..:|...:.:..:.|:..:.|.:|:|       :::.......|:...:|:..|:..|.  ..|.
Mouse   400 PAYICLCIWLKRVGRRKTMLLFLLVSSLTCMLHVVMPSDYKTAKRMVALLVKSVISSVF--AFIY 462

  Fly   418 LATSVL----VDCLPV 429
            |.|:.|    |.||.|
Mouse   463 LYTAELYPTTVRCLAV 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 82/406 (20%)
MFS 23..>208 CDD:119392 32/158 (20%)
MFS 354..>482 CDD:304372 19/87 (22%)
Slc22a16NP_081848.1 2A0119 14..535 CDD:273328 82/406 (20%)
MFS 163..525 CDD:119392 82/404 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 530..560
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 579..649
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843398
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.