DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33233 and Slc22a21

DIOPT Version :9

Sequence 1:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_062697.1 Gene:Slc22a21 / 56517 MGIID:1929481 Length:564 Species:Mus musculus


Alignment Length:477 Identity:89/477 - (18%)
Similarity:170/477 - (35%) Gaps:134/477 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 EFDTSPKE--KTLLANSLLGGMVASGLFI-GFLADRYGRKFVIRLALVGALSFSVISALMPDLYS 111
            |:|...|:  |..|..|.....|..|.|| |.|:||:|||.::.|.:.....||.|.....:...
Mouse   131 EWDLVCKDDWKAPLTTSFFYVGVLLGSFISGQLSDRFGRKNILFLTMAMHTGFSFIQVFSVNFEM 195

  Fly   112 LSVIRIIVGTFLSAVASLQVGFLGEFHAIKWRPITVAICSQSQGLALIYCPLVAMAILPNNFNVD 176
            .:::..:||          :|.:..:.|    ...:.....|:.:.:|:..|.........|.|.
Mouse   196 FTLLYTLVG----------MGHISNYVA----AFVLGTEMLSKSVRIIFATLGVCIFFAFGFMVL 246

  Fly   177 LSSSYNLRVWRFLMMFFMIPGWLALVGICLVPETPHFLMSVNRPDKALLALKWICRMNRKKWEDV 241
            ...:|.:|.||.|::...:||.|.......:||:|.:|:|..|..:|.:.::...::|.......
Mouse   247 PLFAYFIREWRRLLLAITLPGVLCGALWWFIPESPRWLISQGRIKEAEVIIRKAAKINGIVAPST 311

  Fly   242 DITLSEEKSSTNDQEGFWKTVWYEYKLLFSKP---HVFKFF----ICLFLIFG-IFFTSIGLGIW 298
            ....||.....:|..              .||   |::...    |.:..|.. |.:.:|.:|.:
Mouse   312 IFDPSETNKLQDDSS--------------KKPQSHHIYDLVRTPNIRILTIMSIILWLTISVGYF 362

  Fly   299 FPVIRNMDNSGSNRLCDLVNNNPTFINHEADDTNGTDSESPKCNDEMTNLIDPVYYGFTYIGCFI 363
                                              |...::|..|            |..|:.||:
Mouse   363 ----------------------------------GLSLDTPNLN------------GNIYVNCFL 381

  Fly   364 LASV----------LVHWMTRKYVIALHILISMILGISLNIMKQPTVVLIFFVLMMVLPGVLIPL 418
            ||:|          |:..::|:|.:|    .|:.||.|:            .:|:.::|..|..|
Mouse   382 LAAVEVPAYVLAWLLLQHVSRRYSMA----GSLFLGGSV------------LLLVQLVPSDLHYL 430

  Fly   419 ATSVLV------------------DCLPVNLRGKALCMVRSLARFGGVLGS--TMIGLFIRVTCD 463
            :|::::                  :..|..:|...:.:..:.:|.|.:|..  ..:|.:.|   .
Mouse   431 STTLVMVGKFGITSAYSMVYVYTAELYPTVVRNMGVGVSSTASRLGSILSPYFVYLGAYDR---R 492

  Fly   464 VTFNIFNLCLAICVVLAVFQPK 485
            :.:.:......:..::.:|.|:
Mouse   493 LPYILMGSLTILTAIITLFFPE 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 85/439 (19%)
MFS 23..>208 CDD:119392 38/160 (24%)
MFS 354..>482 CDD:304372 27/157 (17%)
Slc22a21NP_062697.1 2A0119 12..523 CDD:273328 89/477 (19%)
MFS 123..513 CDD:119392 88/474 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 532..564
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843436
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.