DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33233 and si:dkey-119m7.4

DIOPT Version :9

Sequence 1:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_001038399.1 Gene:si:dkey-119m7.4 / 560629 ZFINID:ZDB-GENE-040724-70 Length:413 Species:Danio rerio


Alignment Length:290 Identity:74/290 - (25%)
Similarity:131/290 - (45%) Gaps:36/290 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SVTESMTAGY------LVVLTSCEFDTSPKEKTL--LANSL-LGGMVASGLFIGFLADRYGRKFV 88
            |..:..|.|:      .:...:.|:|...:..|:  :.:|: :.|::...:..|.|||:|||:.:
Zfish    97 STAKGCTGGWEFSKEVFLSTIATEWDLVCENATMNNIGSSIYMFGLLVGAVLFGALADKYGRRII 161

  Fly    89 IRLALVGALSFSVISALMPDLYSLSVIRIIVGTFLSAVASLQVGFLG-EFHAIKWRPITVAICSQ 152
            |.:.|.....|.|.:|..|:.|...::|.:|||.:|||. :....|| |:...|.|.:...|...
Zfish   162 ILIGLAIQAIFGVGAAFAPNFYIYVLLRFVVGTTVSAVI-MNAFVLGTEWTGPKKRMLAGVITDY 225

  Fly   153 SQGLALIYCPLVAMAILPNNFNVDLSSSYNLRVWRFLMMFFMIPGWLALVGICLVPETPHFLMSV 217
            ..|...|....||               |.:|.||.|.:....|.:|.|..:.::|::..:||:.
Zfish   226 FFGFGYILLAGVA---------------YLIRDWRKLQLAISAPSFLFLFYVWVLPKSARWLMAN 275

  Fly   218 NRPDKALLALKWICRMNRKKWEDVDITLSEE-KSSTNDQEGFWKTVWYEYKLLFSKPHVFKFFIC 281
            |:.::||..::....:|.|..||.|:.|.:. |||...||....||..    |...|.:.|..:.
Zfish   276 NKHEEALDLIRKAALINGKPLEDDDMELYQSPKSSEKLQEQRKYTVLD----LVRTPRMRKQSLI 336

  Fly   282 LFLIFGIFFTSIGLGIWFPVIRNMDNSGSN 311
            ||.::     .:.:.:::.:..|:.:.|.|
Zfish   337 LFYLW-----FVNVLVYYGLSLNISDFGMN 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 74/290 (26%)
MFS 23..>208 CDD:119392 47/184 (26%)
MFS 354..>482 CDD:304372
si:dkey-119m7.4NP_001038399.1 2A0119 11..413 CDD:273328 74/290 (26%)
MFS 112..>273 CDD:119392 45/176 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588516
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.