DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33233 and svopb

DIOPT Version :9

Sequence 1:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster
Sequence 2:XP_021327288.1 Gene:svopb / 555216 ZFINID:ZDB-GENE-070705-359 Length:266 Species:Danio rerio


Alignment Length:113 Identity:24/113 - (21%)
Similarity:48/113 - (42%) Gaps:13/113 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 GLFIG-FLADRYGRKFVIRLALVGALSFSVISALMPDLYS------LSVIRIIVGTFLSAVASLQ 130
            ||.:. ::.:|..|    |.::|  :.||:.:..:..||:      |:|...|..|.::|...:.
Zfish   103 GLLVALWMVNRISR----RKSMV--ICFSLFTVCILPLYACTHRIVLTVFIFIARTSINAGWQIA 161

  Fly   131 VGFLGEFHAIKWRPITVAICSQSQGLALIYCPLVAMAILPNNFNVDLS 178
            ..:..|......|.|.:...|....:..:..|.:|..:|.::..:.||
Zfish   162 YVYTPEVFPTATRAIGIGTSSGMSRVGALVTPFIAQVLLKSSVYLTLS 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 24/113 (21%)
MFS 23..>208 CDD:119392 24/113 (21%)
MFS 354..>482 CDD:304372
svopbXP_021327288.1 Sugar_tr <23..236 CDD:331684 24/113 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.